<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06996
Description |
Mediator of RNA polymerase II transcription subunit 28 |
Sequence | MSVIIFQQCLSILTKDEGLGNSGTGASGGLTVDKDEGRAEIEQATMRFIDLARQMEAFFLQKRFLLSALKPEMLVKEEINELKLELARKEELIKRHNDKISVWQNMLSDLQGWAQSPAQGPAPSGLPNGNQSGQNQQATGGSGNASMQQQQQILQHQQQLQQQLQQQQQQQHPQLQQQLQQQMQHPLQPQVQQGSGGPPTSGLQGVGVPVNQQGMFMAQGGVGGRATGFPVGGMGSSALQGPLAYLEKTTSNIGMPERRS |
Length | 260 |
Position | Head |
Organism | Trachymyrmex zeteki |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Trachymyrmex.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.640 |
Instability index | 71.32 |
Isoelectric point | 6.43 |
Molecular weight | 28261.52 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP06996
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.53| 18| 18| 148| 165| 1
---------------------------------------------------------------------------
148- 165 (36.75/15.38) QQQQQILQHQQQLQQQLQ
167- 184 (37.78/16.03) QQQQQHPQLQQQLQQQMQ
---------------------------------------------------------------------------
|