Description | Mediator of RNA polymerase II transcription subunit 21 |
Sequence | MDIISQLQEQVNLIAHLAFNTVGTLQRDAPPNRLSPNYPEPPPHTTEDGTNFSEQPKLMSSALVKAAKQFDALVTALPISEGGEEAQIKRITELQAENDAIGQELQKQLEAAEKELNEVQELFRQASDNCLNLKKPDDN |
Length | 139 |
Position | Middle |
Organism | Cajanus cajan (Pigeon pea) (Cajanus indicus) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Cajanus. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.650 |
Instability index | 55.41 |
Isoelectric point | 4.52 |
Molecular weight | 15390.98 |
Publications | PubMed=22057054 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP06990 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 41.79| 14| 16| 74| 89| 1 --------------------------------------------------------------------------- 74- 87 (23.25/19.18) VTALPISEG..GEEAQ 91- 106 (18.54/ 6.56) ITELQAENDaiGQELQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EEAQIKRITELQAENDAIGQELQK 2) EQPKLMSSALVKAAKQFDALVTALPI | 84 54 | 107 79 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab