<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06951
| Description |
Cyclin-C1-2 |
| Sequence | MAANFWTSSHYKHLLDQEDVDMVNPLDKEKGITLEDFKLIKMHMANYILKLAQQVKVRQRVVATAVTYMRRVYTKKSMTEYDPRLVAPTCLYLASKAEESTVQARLLVFYIKKLYADDKYRYEIKDILEMEMKVLEALNYYLVVYHPYRSLSPLLQDAGLNDLNMTQLTWGLVNDTYKMDLILVHPPHLIALACIYIASVLREKDTTAWFEELRVDMNVVKNISMEILDFYESNRMFTEERINAALQKLTLRP |
| Length | 253 |
| Position | Kinase |
| Organism | Cajanus cajan (Pigeon pea) (Cajanus indicus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Cajanus.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.153 |
| Instability index | 42.32 |
| Isoelectric point | 6.61 |
| Molecular weight | 29737.40 |
| Publications | PubMed=22057054
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
DNA-directed 5'-3' RNA polymerase activity GO:0003899 IEA:UniProtKB-EC
|
| GO - Biological Process | cell cycle GO:0007049 IEA:UniProtKB-KW
cell division GO:0051301 IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06951
No repeats found
|