<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06950
Description |
Uncharacterized protein |
Sequence | MDPEGKKFGGGPRELTSAVDLISHFKLIPHYEFFCKRSLPVSIADTHYLHNVVGDTEIRKGDGMQLDQLIQNTSSYRDTNARIQPFDLDVLKETFQLRETAPIDLPAAEKGIPTIAGKSKGENKEKEKKHKKHKDKDKEHKKHKHRHKDRSKDKDKDKKKDKSGHRDSGADHSKKHHEKKRKHDGDDDVNHVHKHKKSKHKSSKIDQLGAIKVAG |
Length | 215 |
Position | Head |
Organism | Cajanus cajan (Pigeon pea) (Cajanus indicus) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Cajanus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -1.395 |
Instability index | 30.90 |
Isoelectric point | 9.63 |
Molecular weight | 24596.49 |
Publications | PubMed=22057054
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP06950
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.01| 15| 15| 165| 179| 3
---------------------------------------------------------------------------
172- 187 (22.99/ 7.11) HSKKHHEKkRKHDGDD
191- 206 (22.02/ 6.54) HVHKHKKSkHKSSKID
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.98| 15| 20| 70| 88| 5
---------------------------------------------------------------------------
70- 88 (21.97/21.01) IQNTSSYRDTnariQPFDL
91- 105 (25.01/14.15) LKETFQLRET....APIDL
---------------------------------------------------------------------------
|