| Description | Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MAAAPGNAMMEGGAVAQPPGTDMTGICFRDQLWLNSFILANPNSLLHSLFRKMTGTEYVLSEVMEPHLFVIRKQKRDSPDKVTPMLAYYVLDGSIYQAPQLCNVFAARIGRALYYIQKAFTTAASKLEKIGYAGSADSENETALPESKTVKETIDIKEVKRVDHILASLQRKLPPAPPPPAFPEGYVPPPTGETEKGTETQEAAETQAPTADPIIDQGPAKRMKF |
| Length | 225 |
| Position | Head |
| Organism | Cajanus cajan (Pigeon pea) (Cajanus indicus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Cajanus. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.327 |
| Instability index | 44.90 |
| Isoelectric point | 5.98 |
| Molecular weight | 24595.94 |
| Publications | PubMed=22057054 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP06947 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) DHILASLQRKL 2) PEGYVPP 3) PIIDQGPAKRMKF | 163 183 213 | 173 189 225 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab