<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06944
| Description |
Uncharacterized protein |
| Sequence | MDPDSKKFGGGPRELTGSVDLLNHFKLLPHFEFFCKRPLPVSISDAHYLHNIVGDTEIRKGDGMQLDQLIQNSSLSSGTNYRIQPLDFDILKEAFQLKENAPIDLPAAEKGIPTVAGKSKGESKDEKKHKKHKDRDKDKDKEHRKHKHRQKDRSQDKEKDKKKDKSRHNDSSADPSKKHHEKVDNFSYDAFALLM |
| Length | 195 |
| Position | Head |
| Organism | Cajanus cajan (Pigeon pea) (Cajanus indicus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Cajanus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -1.232 |
| Instability index | 31.34 |
| Isoelectric point | 9.17 |
| Molecular weight | 22363.91 |
| Publications | PubMed=22057054
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06944
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 77.68| 16| 16| 127| 142| 1
---------------------------------------------------------------------------
127- 142 (29.14/13.19) KKHK.KHKDRDKDKDKE
144- 160 (24.99/10.33) RKHKhRQKDRSQDKEKD
162- 178 (23.55/ 9.34) KKDKsRHNDSSADPSKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.10| 13| 15| 49| 61| 2
---------------------------------------------------------------------------
49- 61 (21.20/17.19) LHNIVGDTEIRKG
66- 78 (19.90/15.71) LDQLIQNSSLSSG
---------------------------------------------------------------------------
|