<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06943
| Description |
Uncharacterized protein |
| Sequence | MDPDSKKFGGGPRELTGSVDLLNHFKLLPHFEFFCKRPLPVSISDAHYLHNVVGDTEIRKGDGMQLDQLIQNTSLSSGTNYRIQPLDLDILKEAFQLKETAPIDLPAAEKGILTVAGKSKDESKDEKKHKKHKDRDKGKDKEHRKHKHRLKDRSKDKEKDKKKDKSRHNDSSADPSKKHHEKKRKHDGDDDLTNVHKHKKSKHKSSKIDELGAIKVAG |
| Length | 218 |
| Position | Head |
| Organism | Cajanus cajan (Pigeon pea) (Cajanus indicus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Cajanus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.318 |
| Instability index | 28.37 |
| Isoelectric point | 9.55 |
| Molecular weight | 24833.82 |
| Publications | PubMed=22057054
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06943
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.04| 15| 15| 145| 159| 3
---------------------------------------------------------------------------
145- 159 (28.04/12.26) KHKHRLKDRSKDKEK
163- 177 (26.01/10.87) KDKSRHNDSSADPSK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.20| 13| 15| 49| 61| 4
---------------------------------------------------------------------------
49- 61 (21.64/17.99) LHNVVGDTEIRKG
66- 78 (20.56/16.73) LDQLIQNTSLSSG
---------------------------------------------------------------------------
|