<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06942
| Description |
Uncharacterized protein (Fragment) |
| Sequence | KELGGTRDIINQYRLLPYYEFFCKRSLPKSIQETHYLHNVVGNTKIRKGEGMELDQLCKNTDTSEKKAALCPFDLDVLTEAFHMREMNPVHLSSKGLPNAVTMLENQSRDHERKNKKIKDKCEKYRKQKRRQHRVNDGSCIENIRIRPHDPRILQLKNQQDKVCSLSFPMLCIVCVTLN |
| Length | 179 |
| Position | Head |
| Organism | Cajanus cajan (Pigeon pea) (Cajanus indicus) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Cajanus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.799 |
| Instability index | 41.86 |
| Isoelectric point | 9.36 |
| Molecular weight | 20969.07 |
| Publications | PubMed=22057054
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06942
No repeats found
No repeats found
|