<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06914

Description Uncharacterized protein
SequenceMDKVADSLENAYNEYVEAGRIALEEKEIESKTAKDDVGKEVLEAEKDDASSTSSYPKALENFKEKYEVFKDVCDKAEVFVETVKQKIVFEVDEPTKPSTSDPK
Length103
PositionTail
OrganismCajanus cajan (Pigeon pea) (Cajanus indicus)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Cajanus.
Aromaticity0.08
Grand average of hydropathy-0.846
Instability index21.61
Isoelectric point4.48
Molecular weight11615.71
Publications
PubMed=22057054

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process
cold acclimation	GO:0009631	IEA:InterPro
leaf senescence	GO:0010150	IEA:InterPro
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro
root development	GO:0048364	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP06914
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.21|      14|      18|      19|      32|       1
---------------------------------------------------------------------------
   19-   32 (23.21/12.44)	GRIALE.EKEIESKT
   38-   52 (19.00/ 9.15)	GKEVLEaEKDDASST
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      30.85|      10|      18|      60|      70|       2
---------------------------------------------------------------------------
   60-   70 (13.91/14.54)	ENFKEKYeVFK
   81-   90 (16.94/11.37)	ETVKQKI.VFE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP06914 with Med32 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




NANANA









Molecular Recognition Features






MoRF SequenceStartStop




1) KVADSLENAYNEYVEAGRIALEEKEIESKTAKDDVGKEVLEAEKDDASSTSSYPKALENFKEKYEVFKDVCDKAEVFVETVKQKIVFEVDEPTKPST
3
99