<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06913
Description |
Uncharacterized protein |
Sequence | MDMVYHPYECNTKCSMNLIIKKSQWKDESLLSGLFQHLERYEAKLNATAKTQENCSLLQEIRDINNLLIDSEIVIGEKDSILSAAGGAAEHGEGLVIKFVFNAVTVNQNLHLSSDKKSIIKPLWLLVPTSYPFSPPVILEMLSEVSEGLGDLSTIAKSNLIYSLQHLNQPRTLMNIATSWERCAREAILEYAQARGGGTFSSIYGGWEMCEKYF |
Length | 214 |
Position | Tail |
Organism | Cajanus cajan (Pigeon pea) (Cajanus indicus) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> indigoferoid/millettioid clade> Phaseoleae> Cajanus.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.120 |
Instability index | 35.72 |
Isoelectric point | 5.41 |
Molecular weight | 23980.23 |
Publications | PubMed=22057054
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP06913
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.21| 14| 25| 172| 185| 1
---------------------------------------------------------------------------
172- 185 (26.74/15.51) TLMNIATSWERCAR
199- 212 (28.48/16.87) TFSSIYGGWEMCEK
---------------------------------------------------------------------------
|