<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06909
Description |
Mediator of RNA polymerase II transcription subunit 28 |
Sequence | MFTNQPPGPPPPPPPPGPPGGPGPAGLLPAAAGPRNPNSTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKEALIQKHLGKLRHWQQVLEDISVQHKKPAEMPQGPLAYLEQASANIPAPMKQT |
Length | 175 |
Position | Head |
Organism | Alligator mississippiensis (American alligator) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Crocodylia> Alligatoridae> Alligatorinae>
Alligator.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.595 |
Instability index | 60.53 |
Isoelectric point | 5.42 |
Molecular weight | 19260.70 |
Publications | PubMed=22293439
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP06909
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.06| 15| 16| 102| 116| 1
---------------------------------------------------------------------------
102- 116 (24.51/14.98) QKPEQVIKEDVSELR
120- 134 (24.55/15.01) QRKEALIQKHLGKLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.14| 14| 18| 140| 155| 2
---------------------------------------------------------------------------
140- 155 (21.65/17.81) LEDISvqHKKPAEMPQ
161- 174 (25.49/14.34) LEQAS..ANIPAPMKQ
---------------------------------------------------------------------------
|