<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06906
| Description |
Uncharacterized protein |
| Sequence | MDGQMGPSSNSSSHTMSSKHNMSGGEFQGKREKSDKDKSKVSVSGGSVDSSKKTSDSKNVGSTGVAKIIISKHDGGSPSIKAKVTLQKPGEGGGDSLRPQMASSKSYGSPLISGSTPKHERCSPSHSKSPAYTPQNIDSESESGSSIAEKSYQNSPSSDDGIRPLPEYSSEKHKKHKKEKKKVKDKDRDRERDRDKDRDKKKSHSIKPESWSKSPISSDQSLSMTSSGILSADRPSRPSPDFLIGEEDDDLMDVALIGN |
| Length | 259 |
| Position | Middle |
| Organism | Alligator mississippiensis (American alligator) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Crocodylia> Alligatoridae> Alligatorinae>
Alligator.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.230 |
| Instability index | 56.87 |
| Isoelectric point | 9.22 |
| Molecular weight | 27854.29 |
| Publications | PubMed=22293439
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP06906
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.52| 21| 29| 40| 61| 1
---------------------------------------------------------------------------
40- 61 (26.38/10.62) KVSVSgGSVDSSKKTSDSKNVG
109- 129 (31.15/ 9.44) SPLIS.GSTPKHERCSPSHSKS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 89.10| 29| 146| 4| 38| 2
---------------------------------------------------------------------------
4- 38 (46.95/29.41) QMGPSSNSSSHTM....SSKHNmsggefQGKREKSD.KDK
153- 186 (42.16/16.46) QNSPSSDDGIRPLpeysSEKHK......KHKKEKKKvKDK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.08| 15| 15| 66| 80| 4
---------------------------------------------------------------------------
66- 80 (25.21/11.74) AKIIISKH.DGGSPSI
82- 97 (19.88/ 7.70) AKVTLQKPgEGGGDSL
---------------------------------------------------------------------------
|