<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06882
Description |
Mediator of RNA polymerase II transcription subunit 15 |
Sequence | MGASGQMITATMARGGMQIRPRFPPTTAVSATPPSSIPLGGQQMPQVSQNNITMMSSPSPVQQAQTPQSMPPPPQPQPSPQPGQPTSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPAAARTPQNFSVPSPGPLNTPGNPNSVMSPASSNQSEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFMPAMTAIHGPPITAPVASPRKRKYEEDERQTIPNVLQGEVARLNPKFLVNLDPSHCSNNGTVHLICKLDDKNLPNVPPLQLSVPADYPDQSPLWIDNPRQYAANPFLQSVYRYMTSKLLQLPDKHSVTALLNTWAQSIRQACLSAA |
Length | 412 |
Position | Tail |
Organism | Alligator mississippiensis (American alligator) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Crocodylia> Alligatoridae> Alligatorinae>
Alligator.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.590 |
Instability index | 84.05 |
Isoelectric point | 9.50 |
Molecular weight | 44973.04 |
Publications | PubMed=22293439
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364148
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP06882
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 156.58| 28| 28| 74| 101| 1
---------------------------------------------------------------------------
30- 54 (40.35/ 9.79) SATP.P.....SS.......I.PLGGQQMPQ.VSQNNITM
55- 93 (44.89/11.73) MSSPSPvqqaqTPqsmpppPQ.PQPSPQPGQPTSQPNSNV
117- 143 (32.81/ 6.55) ..AAAR.....TP......QNfSVPSPGPLNTPGNPNSVM
223- 244 (38.53/ 9.00) MAVPTP......P......PP.PVP.PTKQQYLCQP....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.53| 14| 22| 306| 319| 2
---------------------------------------------------------------------------
306- 319 (24.62/14.41) VARLNPKFLVNLDP
331- 344 (26.92/16.49) ICKLDDKNLPNVPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.94| 22| 37| 151| 186| 3
---------------------------------------------------------------------------
151- 173 (33.84/43.10) SEEQQYLDKLKQLSKYIePLRRM
188- 209 (38.10/16.06) SKMKSLLDILTDPSKRC.PLKTL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.79| 12| 239| 105| 116| 7
---------------------------------------------------------------------------
105- 116 (24.90/ 8.99) LPSPSPQPSQSP
347- 358 (23.89/ 8.35) LSVPADYPDQSP
---------------------------------------------------------------------------
|