<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06882

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMGASGQMITATMARGGMQIRPRFPPTTAVSATPPSSIPLGGQQMPQVSQNNITMMSSPSPVQQAQTPQSMPPPPQPQPSPQPGQPTSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPAAARTPQNFSVPSPGPLNTPGNPNSVMSPASSNQSEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFMPAMTAIHGPPITAPVASPRKRKYEEDERQTIPNVLQGEVARLNPKFLVNLDPSHCSNNGTVHLICKLDDKNLPNVPPLQLSVPADYPDQSPLWIDNPRQYAANPFLQSVYRYMTSKLLQLPDKHSVTALLNTWAQSIRQACLSAA
Length412
PositionTail
OrganismAlligator mississippiensis (American alligator)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Crocodylia> Alligatoridae> Alligatorinae> Alligator.
Aromaticity0.04
Grand average of hydropathy-0.590
Instability index84.05
Isoelectric point9.50
Molecular weight44973.04
Publications
PubMed=22293439

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
ECO:0000256	RuleBase:RU364148
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP06882
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     156.58|      28|      28|      74|     101|       1
---------------------------------------------------------------------------
   30-   54 (40.35/ 9.79)	SATP.P.....SS.......I.PLGGQQMPQ.VSQNNITM
   55-   93 (44.89/11.73)	MSSPSPvqqaqTPqsmpppPQ.PQPSPQPGQPTSQPNSNV
  117-  143 (32.81/ 6.55)	..AAAR.....TP......QNfSVPSPGPLNTPGNPNSVM
  223-  244 (38.53/ 9.00)	MAVPTP......P......PP.PVP.PTKQQYLCQP....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.53|      14|      22|     306|     319|       2
---------------------------------------------------------------------------
  306-  319 (24.62/14.41)	VARLNPKFLVNLDP
  331-  344 (26.92/16.49)	ICKLDDKNLPNVPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.94|      22|      37|     151|     186|       3
---------------------------------------------------------------------------
  151-  173 (33.84/43.10)	SEEQQYLDKLKQLSKYIePLRRM
  188-  209 (38.10/16.06)	SKMKSLLDILTDPSKRC.PLKTL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.79|      12|     239|     105|     116|       7
---------------------------------------------------------------------------
  105-  116 (24.90/ 8.99)	LPSPSPQPSQSP
  347-  358 (23.89/ 8.35)	LSVPADYPDQSP
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP06882 with Med15 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) IEPLRRMINKIDKNEDRKKDLSKMKSLLDI
2) MGASGQMITATMARGGMQIRPRFPPTTAVSATPPSSIPLGGQQMPQVSQNNITMMSSPSPVQQAQTPQSMPPPPQPQPSPQPGQPTSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPAAARTPQNFSVPSPGPLNTPGNPNSVMSPASSNQSEEQQYLDKLKQLS
167
1
196
164

Molecular Recognition Features

MoRF SequenceStartStop
NANANA