<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06881
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MGASGQVSQNNITMMSSPSPVQQAQTPQSMPPPPQPQPSPQPGQPTSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPAAARTPQNFSVPSPGPLNTPGNPNSVMSPASSNQSEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFMPAMTAIHGPPITAPVASPRKRKYEEDERQTIPNVLQGEVARLNPKFLVNLDPSHCSNNGTVHLICKLDDKNLPNVPPLQLSVPADYPDQSPLWIDNPRQYAANPFLQSVYRYMTSKLLQLPDKHSVTALLNTWAQSIRQACLSAA |
| Length | 372 |
| Position | Tail |
| Organism | Alligator mississippiensis (American alligator) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Crocodylia> Alligatoridae> Alligatorinae>
Alligator.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.635 |
| Instability index | 86.41 |
| Isoelectric point | 9.29 |
| Molecular weight | 40809.17 |
| Publications | PubMed=22293439
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06881
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 126.18| 28| 28| 34| 61| 1
---------------------------------------------------------------------------
26- 59 (53.60/20.16) TPqsmpppPQ....PQPSPQPGQPTSQPNSNVSSGPAP
60- 80 (28.23/ 6.75) SP........ssflPSPSPQPSQ.........SPAAAR
81- 107 (44.34/15.27) TP......QN...fSVPSPGPLNTPGNPNSVMS..PAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.93| 27| 156| 132| 166| 2
---------------------------------------------------------------------------
132- 165 (35.51/33.33) RMiNKIDKNedrkkdLSKMKSLLDILTDPSKRCP
168- 194 (45.42/20.15) TL.QKCEIA......LEKLKNDMAVPTPPPPPVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.53| 14| 22| 266| 279| 4
---------------------------------------------------------------------------
266- 279 (24.62/12.93) VARLNPKFLVNLDP
291- 304 (26.92/14.80) ICKLDDKNLPNVPP
---------------------------------------------------------------------------
|