<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06881

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMGASGQVSQNNITMMSSPSPVQQAQTPQSMPPPPQPQPSPQPGQPTSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPAAARTPQNFSVPSPGPLNTPGNPNSVMSPASSNQSEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFMPAMTAIHGPPITAPVASPRKRKYEEDERQTIPNVLQGEVARLNPKFLVNLDPSHCSNNGTVHLICKLDDKNLPNVPPLQLSVPADYPDQSPLWIDNPRQYAANPFLQSVYRYMTSKLLQLPDKHSVTALLNTWAQSIRQACLSAA
Length372
PositionTail
OrganismAlligator mississippiensis (American alligator)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Crocodylia> Alligatoridae> Alligatorinae> Alligator.
Aromaticity0.05
Grand average of hydropathy-0.635
Instability index86.41
Isoelectric point9.29
Molecular weight40809.17
Publications
PubMed=22293439

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364148
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP06881
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     126.18|      28|      28|      34|      61|       1
---------------------------------------------------------------------------
   26-   59 (53.60/20.16)	TPqsmpppPQ....PQPSPQPGQPTSQPNSNVSSGPAP
   60-   80 (28.23/ 6.75)	SP........ssflPSPSPQPSQ.........SPAAAR
   81-  107 (44.34/15.27)	TP......QN...fSVPSPGPLNTPGNPNSVMS..PAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.93|      27|     156|     132|     166|       2
---------------------------------------------------------------------------
  132-  165 (35.51/33.33)	RMiNKIDKNedrkkdLSKMKSLLDILTDPSKRCP
  168-  194 (45.42/20.15)	TL.QKCEIA......LEKLKNDMAVPTPPPPPVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.53|      14|      22|     266|     279|       4
---------------------------------------------------------------------------
  266-  279 (24.62/12.93)	VARLNPKFLVNLDP
  291-  304 (26.92/14.80)	ICKLDDKNLPNVPP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP06881 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) IEPLRRMINKIDKNEDRKKDLSKMKSLLDI
2) MGASGQVSQNNITMMSSPSPVQQAQTPQSMPPPPQPQPSPQPGQPTSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPAAARTPQNFSVPSPGPLNTPGNPNSVMSPASSNQSEEQQYLDKLKQLS
127
1
156
124










Molecular Recognition Features






MoRF SequenceStartStop




NANANA