<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06880
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MDVSGQDSDWRSANFRQKLVSQIDEAMRKAGVAHNKSSKDMESHVFMKAKSRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQNLTGGPPAGTAGMGMASRTQGAPMGGMSGLGPMGQQMSLPGQQPPGTSGMAPHGMPGVSTATQQSKCSVCLQIINR |
| Length | 162 |
| Position | Tail |
| Organism | Alligator mississippiensis (American alligator) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Crocodylia> Alligatoridae> Alligatorinae>
Alligator.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.486 |
| Instability index | 53.57 |
| Isoelectric point | 9.69 |
| Molecular weight | 17212.49 |
| Publications | PubMed=22293439
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06880
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.64| 14| 15| 90| 104| 1
---------------------------------------------------------------------------
101- 116 (21.53/ 9.16) MASRtqGAPMGGMSGL
123- 136 (29.10/ 9.58) MSLP..GQQPPGTSGM
---------------------------------------------------------------------------
|