<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06879
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MGASGQMITATMARGGMQIRPRFPPTTAVSATPPSSIPLGGQQMPQVSQNNITMMSSPSPVQQAQTPQSMPPPPQPQPSPQPGQPTSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPAAARTPQNFSVPSPGPLNTPGNPNSVMSPASSNQSEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFMPAMTAIHGPPITAPVASPRKRKYEEDERQTIPNVLQGEVARLNPKFLVNLDPSHCSNNGTVHLICKLDDKNLPNVPPLQLSVPADYPDQSPLWIDNPRQYANPFLQSVYRYMTSKLLQLPDKHSVTALLNTWAQSIRQACLSAA |
| Length | 411 |
| Position | Tail |
| Organism | Alligator mississippiensis (American alligator) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Crocodylia> Alligatoridae> Alligatorinae>
Alligator.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.596 |
| Instability index | 84.23 |
| Isoelectric point | 9.50 |
| Molecular weight | 44901.96 |
| Publications | PubMed=22293439
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06879
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 156.58| 28| 28| 74| 101| 1
---------------------------------------------------------------------------
30- 54 (40.35/ 9.69) SATP.P.....SS.......I.PLGGQQMPQ.VSQNNITM
55- 93 (44.89/11.61) MSSPSPvqqaqTPqsmpppPQ.PQPSPQPGQPTSQPNSNV
117- 143 (32.81/ 6.50) ..AAAR.....TP......QNfSVPSPGPLNTPGNPNSVM
223- 244 (38.53/ 8.92) MAVPTP......P......PP.PVP.PTKQQYLCQP....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.53| 14| 22| 306| 319| 2
---------------------------------------------------------------------------
306- 319 (24.62/10.98) VARLNPKFLVNLDP
331- 344 (26.92/12.60) ICKLDDKNLPNVPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 89.95| 28| 203| 145| 179| 3
---------------------------------------------------------------------------
145- 173 (43.15/35.53) PASSNQSEEQQYLDKLKQLSKYIePLRRM
182- 209 (46.80/22.06) DRKKDLSKMKSLLDILTDPSKRC.PLKTL
---------------------------------------------------------------------------
|