<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06875

Description Mediator of RNA polymerase II transcription subunit 25 isoform B
SequenceMVVPGPEAAALGGPGGMVADVVFVIEGTANLGPYFESLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYVQCHAPTSSAYEFVTWLDSIQFVGGGGESCSLIAEGLSTALQLFDDFKKMREQIGQTHKVCILICNSPPYLLPAVESTTYSGYTTENLVQKIGERGIHFSIVSPRKLPALRMLFEKAVPAGMMEAQPKDYSQDPRHMILIRGMALPVGGSAASNTIQPKQVVPQPQLPTAPPQLPPAPPQPLPSASQSYQVTPTNSLNAAQAAAQSAVEAAKNQKAGITRFPMPTAFTQGPAQPLPAGSVPPMAPKMPPSSQPSLVSTVTSSSGLLPQPPGQPPPQPSAPTMPSSVAPSGVSVAQPAASQIGAAQLPGAQQTVASKVVAWSGVLEWQEKPKPASVDSSTKLTRSLPCQVFVNPGENLKTDQWPQKLIMQLIPQQLLTTLGPLFRNSRMVQFNFTNKDLESLKGLYRIMGNGFAGCVHFPHTTPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNGIRQVITNHKQVQQQKIEQQRSLGSSQPLGSAPVPNTQPFLPKQPGALPVAQGVQQQVRMGGILLNVWWWGGGC
Length611
PositionUnknown
OrganismAlligator mississippiensis (American alligator)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Crocodylia> Alligatoridae> Alligatorinae> Alligator.
Aromaticity0.07
Grand average of hydropathy-0.145
Instability index54.15
Isoelectric point8.81
Molecular weight65229.23
Publications
PubMed=22293439

Function

Annotated function 
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP06875
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     323.46|      69|      70|     252|     320|       1
---------------------------------------------------------------------------
  156-  265 (67.38/26.99)	LPA.vESTTYSgyttenlvqkigergihfsiVS.P.RK.LPALR.MLFEKAV..................PA......GMME.AQPKDYSQDPrhmilirgmALPVGgsaasntiqpkqvvpqpqlP.....TAPPQLPPAPPQP
  266-  338 (112.24/50.38)	LPS..ASQSYQ....................VT.PTNS.LNAAQ.AAAQSAV..................EAAKNQKAGITRFPMPTAFTQGP.........AQPLP...............agsvP.....PMAPKMPPSSQPS
  339-  364 (38.02/11.68)	LVS..T.........................VT.SSSG.L.....................................................................................lP.....QPPGQPPPQPSAP
  366-  465 (59.67/22.97)	MPSsvAPSGVS....................VAqPAASqIGAAQlPGAQQTVaskvvawsgvlewqekpkPASVDSSTKLTR.SLPCQVFVNP.........GENLK...............tdqwPqklimQLIPQQLLTTLGP
  466-  506 (46.15/15.92)	LFR..NSRMVQ....................F....NF.TNKDL.ESLKGLY..................RIMGNGFAGCVHFPHTT..........................................................
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP06875 with Med25 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) SAASNTIQPKQVVPQPQLPTAPPQLPPAPPQPLPSASQSYQVTPTNSLNAAQAAAQSAVEAAKNQKAGITRFPMPTAFTQGPAQPLPAGSVPPMAPKMPPSSQPSLVSTVTSSSGLLPQPPGQPPPQPSAPTMPSSVAPSGVSVA
234
378










Molecular Recognition Features






MoRF SequenceStartStop




NANANA