<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06859

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMATDDSWKTPHFRQSVVAKIDEAIQVSGMPTTKNSIEMENHVFQKAKSKEEYLGFVARLILHVREMNSKKSATGNAPGTAGTNNQGMPDPIGALQTLARQGTGNNQMMSMGGPNHQGIISQPPTNTATNLLQSLNQRPAQPINMPGIQNKMPGMGMMPSQTGGPMNHLGPIQSMQNNPMLTQMNQMGQGNIPPQMNQMVPGQMGQLGAGQMQQNMQSQMQTQLPGQMNNQITGPIGNIQTSISQQMNQIGPGQLGPGQMQQQLNHIQRKPSEMMNTGFPGPRNVTPNQFLRQSPSPSAPSPAGLGAPSSNQMVASPALVPSPSPQHAIMTGPTRSVNSVGMAPSPSSSLNTPGGVGATPSPQQEDQAYRDKVRQLSKYIEPLRRMIAKMSCEGNVDKLSKMKKLLEILSNPSKRMPLDTLLKCEVVLEKFNFKRGDGSVGPPVTTLKEHQIFSPLLEAVSAHLQSPVINHTLQRTFGPCLDALFGPEIKNLPPPLKKQKIEESSSEIPDVLQGEIARLDQRFKVSLDPAQQSGSRCIQLICWLDDRHLPCVPPISVTVPADYPSTPPRCVMAPHEYEATTFLCAVQKALNIRIAKLPRRFSLSQLLDTWEMSVRQASAPKEMSITASTVLMGL
Length633
PositionTail
OrganismTrachymyrmex septentrionalis
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea> Formicidae> Myrmicinae> Trachymyrmex.
Aromaticity0.03
Grand average of hydropathy-0.469
Instability index59.42
Isoelectric point9.41
Molecular weight68751.42
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364148

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP06859
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     140.10|      22|      22|     182|     203|       1
---------------------------------------------------------------------------
  136-  155 (29.92/ 9.18)	QR.PAQ...PIN.MPGIQNKMPGMG
  178-  196 (32.70/10.75)	PML.....tQMN.QMGQGNIPPQMN
  197-  212 (24.33/ 6.01)	QMVPGQM.....gQLGAG....QMQ
  253-  275 (26.98/ 7.51)	QLGPGQMqqQLN.HI.QRKPSEMMN
  291-  310 (26.16/ 7.05)	RQSPSPS..APS.PAGLG..APSSN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      56.53|      11|      20|     313|     323|       2
---------------------------------------------------------------------------
  313-  323 (20.12/10.87)	VASPALV.PSPS
  336-  346 (21.06/11.79)	VNSVGMA.PSPS
  349-  360 (15.36/ 6.25)	LNTPGGVgATPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.55|      12|      18|     218|     229|       3
---------------------------------------------------------------------------
  218-  229 (23.90/11.13)	QMQTQLPGQMNN
  237-  248 (20.66/ 8.69)	NIQTSISQQMNQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      86.28|      19|      70|      87|     105|       4
---------------------------------------------------------------------------
   87-  105 (35.46/17.66)	MPDPIGA.LQTLAR.Q...GTGNN
  110-  129 (24.21/ 9.69)	MGGP..N.HQGIIS.QpptNTATN
  157-  177 (26.61/11.39)	MPSQTGGpMNHLGPiQ...SMQNN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.69|      24|      29|     370|     398|       5
---------------------------------------------------------------------------
  370-  398 (37.11/40.34)	DKvrqlsKYIE....PLRRMI..AKMSCEGNVDKL
  401-  430 (31.57/21.62)	MK.....KLLEilsnPSKRMPldTLLKCEVVLEKF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.91|      17|      23|     442|     463|       6
---------------------------------------------------------------------------
  442-  458 (29.57/22.04)	PVTTLKEHQIFSPLLEA
  466-  482 (32.34/13.28)	PVINHTLQRTFGPCLDA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      98.50|      22|      77|     511|     532|       7
---------------------------------------------------------------------------
  511-  532 (38.11/23.02)	LQGEIARLDQRF.....KVS..LD.PAQQS
  537-  563 (28.11/15.24)	IQ.LICWLDDRHlpcvpPIS..VTvPADYP
  589-  612 (32.28/18.49)	LNIRIAKLPRRF.....SLSqlLD.TWEMS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP06859 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MNSKKSATGNAPGTAGTNNQGMPDPIGALQTLARQGTGNNQMMSMGGPNHQGIISQPPTNTATNLLQSLNQRPAQPINMPGIQNKMPGMGMMPSQTGGPMNHLGPIQSMQNNPMLTQMNQMGQGNIPPQMNQMVPGQMGQLGAGQMQQNMQSQMQTQLPGQMNNQITGPIGNIQTSISQQMNQIGPGQLGPGQMQQQLNHIQRKPSEMMNTGFPGPRNVTPNQFLRQSPSPSAPSPAGLGAPSSNQMVASPALVPSPSPQHAIMTGPTRSVNSVGMAPSPSSSLNTPGGVGATPSPQQEDQAYRDKVRQ
66
374










Molecular Recognition Features






MoRF SequenceStartStop




NANANA