<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06859
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MATDDSWKTPHFRQSVVAKIDEAIQVSGMPTTKNSIEMENHVFQKAKSKEEYLGFVARLILHVREMNSKKSATGNAPGTAGTNNQGMPDPIGALQTLARQGTGNNQMMSMGGPNHQGIISQPPTNTATNLLQSLNQRPAQPINMPGIQNKMPGMGMMPSQTGGPMNHLGPIQSMQNNPMLTQMNQMGQGNIPPQMNQMVPGQMGQLGAGQMQQNMQSQMQTQLPGQMNNQITGPIGNIQTSISQQMNQIGPGQLGPGQMQQQLNHIQRKPSEMMNTGFPGPRNVTPNQFLRQSPSPSAPSPAGLGAPSSNQMVASPALVPSPSPQHAIMTGPTRSVNSVGMAPSPSSSLNTPGGVGATPSPQQEDQAYRDKVRQLSKYIEPLRRMIAKMSCEGNVDKLSKMKKLLEILSNPSKRMPLDTLLKCEVVLEKFNFKRGDGSVGPPVTTLKEHQIFSPLLEAVSAHLQSPVINHTLQRTFGPCLDALFGPEIKNLPPPLKKQKIEESSSEIPDVLQGEIARLDQRFKVSLDPAQQSGSRCIQLICWLDDRHLPCVPPISVTVPADYPSTPPRCVMAPHEYEATTFLCAVQKALNIRIAKLPRRFSLSQLLDTWEMSVRQASAPKEMSITASTVLMGL |
| Length | 633 |
| Position | Tail |
| Organism | Trachymyrmex septentrionalis |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Trachymyrmex.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.469 |
| Instability index | 59.42 |
| Isoelectric point | 9.41 |
| Molecular weight | 68751.42 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06859
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
5| 140.10| 22| 22| 182| 203| 1
---------------------------------------------------------------------------
136- 155 (29.92/ 9.18) QR.PAQ...PIN.MPGIQNKMPGMG
178- 196 (32.70/10.75) PML.....tQMN.QMGQGNIPPQMN
197- 212 (24.33/ 6.01) QMVPGQM.....gQLGAG....QMQ
253- 275 (26.98/ 7.51) QLGPGQMqqQLN.HI.QRKPSEMMN
291- 310 (26.16/ 7.05) RQSPSPS..APS.PAGLG..APSSN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 56.53| 11| 20| 313| 323| 2
---------------------------------------------------------------------------
313- 323 (20.12/10.87) VASPALV.PSPS
336- 346 (21.06/11.79) VNSVGMA.PSPS
349- 360 (15.36/ 6.25) LNTPGGVgATPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.55| 12| 18| 218| 229| 3
---------------------------------------------------------------------------
218- 229 (23.90/11.13) QMQTQLPGQMNN
237- 248 (20.66/ 8.69) NIQTSISQQMNQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 86.28| 19| 70| 87| 105| 4
---------------------------------------------------------------------------
87- 105 (35.46/17.66) MPDPIGA.LQTLAR.Q...GTGNN
110- 129 (24.21/ 9.69) MGGP..N.HQGIIS.QpptNTATN
157- 177 (26.61/11.39) MPSQTGGpMNHLGPiQ...SMQNN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.69| 24| 29| 370| 398| 5
---------------------------------------------------------------------------
370- 398 (37.11/40.34) DKvrqlsKYIE....PLRRMI..AKMSCEGNVDKL
401- 430 (31.57/21.62) MK.....KLLEilsnPSKRMPldTLLKCEVVLEKF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.91| 17| 23| 442| 463| 6
---------------------------------------------------------------------------
442- 458 (29.57/22.04) PVTTLKEHQIFSPLLEA
466- 482 (32.34/13.28) PVINHTLQRTFGPCLDA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 98.50| 22| 77| 511| 532| 7
---------------------------------------------------------------------------
511- 532 (38.11/23.02) LQGEIARLDQRF.....KVS..LD.PAQQS
537- 563 (28.11/15.24) IQ.LICWLDDRHlpcvpPIS..VTvPADYP
589- 612 (32.28/18.49) LNIRIAKLPRRF.....SLSqlLD.TWEMS
---------------------------------------------------------------------------
|