Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MIENTIAQKPSKLSSTEHSQLTELLVAKDNELKATLKRAADQAKINLKMEALKAEVERQDQDIQQLQRQLKEAEQILATAIYQAKQKLQSIARANKRPVPSEELIKYAHRISATNAICAPLTWQQGDPRRPYPTDLEMRVGFLGRLSDPSNLPLNGQLLGSHLGVPSDLHRAGHPAGEPPVSQSNQFAWHPSGEIHMSVGGQGSVAVNTHKQETEDVEVMSTDSSSSSSSDSQ |
Length | 233 |
Position | Middle |
Organism | Trachymyrmex septentrionalis |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea> Formicidae> Myrmicinae> Trachymyrmex. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.657 |
Instability index | 63.23 |
Isoelectric point | 6.25 |
Molecular weight | 25556.35 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP06858 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 110.90| 29| 32| 96| 124| 1 --------------------------------------------------------------------------- 70- 89 (20.55/ 8.76) ...........LKEAEQILATAIYQAKQKLQ 96- 124 (52.54/31.79) KRPVPSE.EL.IKYAHRISATNAICAPLTWQ 129- 157 (37.82/21.19) RRPYPTDlEMrVGFLGRLSDPSNL..PLNGQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 60.96| 15| 15| 172| 186| 2 --------------------------------------------------------------------------- 172- 186 (29.63/17.09) AGHPAGEPPVSQSNQ 188- 202 (31.33/18.41) AWHPSGEIHMSVGGQ --------------------------------------------------------------------------- |
IDR Sequence | Start | Stop |
1) PLNGQLLGSHLGVPSDLHRAGHPAGEPPVSQSNQFAWHPSGEI 2) SVGGQGSVAVNTHKQETEDVEVMSTDSSSSSSSDSQ | 153 198 | 195 233 |
MoRF Sequence | Start | Stop |
NA | NA | NA |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab