<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06856
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MNRLDDPPGLMKGRKPSFIGMNGAPETDDQQRVRFQVELEFVQCLANPNYLNFLAQRGYFKDATFINYLKYLLYWKEPEYAKYLKYPMCLYFLDLLQYEHFRREVVNSQCTKFIDDQQILLWQHYTRRRTRLLQTAVEQTQHTNSQNNGIVQPKVP |
Length | 156 |
Position | Middle |
Organism | Trachymyrmex septentrionalis |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Trachymyrmex.
|
Aromaticity | 0.14 |
Grand average of hydropathy | -0.660 |
Instability index | 37.56 |
Isoelectric point | 8.94 |
Molecular weight | 18752.25 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP06856
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.16| 21| 44| 39| 76| 1
---------------------------------------------------------------------------
48- 71 (34.13/38.62) PNYLNFLAqrgYFKDATFINYLKY
78- 98 (41.03/11.04) PEYAKYLK...YPMCLYFLDLLQY
---------------------------------------------------------------------------
|