<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06852
| Description |
Cell division protein kinase 8 |
| Sequence | MMDYEFKMKTQKDRTKVEDLFEFEGCKVGRGTYGHVYKAHSELKSRPDTKDFGLKQIEGTGLSMSACREIALLRELKHVNVITLIRVFLSHNDRKVWLLFDFAEHDLWHIIKFHRAAKANKKPVMVPKGMVKSLLYQILDGIHYLHSNWVLHRDLKPANILVMGEGNERGRVKIADMGFARLFNAPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPLEKDWEDIKKMPEHPTLLRDFKRSNYANCSLTKYMDRHKIKPDSKAFNLLQKLLMMDPNKRITSEHSMQDAYFQEEPLPTQDIFAGCPIPYPKREFLTDDDTEEKTENKARQNQQQTQQQTQQQQGNGDHNHGQNAKRVRLNGPHGAPEFHQHQSHTMPHQQPGMVYSTTQPTQSSNFHQRF |
| Length | 447 |
| Position | Kinase |
| Organism | Trachymyrmex cornetzi |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Trachymyrmex.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.697 |
| Instability index | 42.06 |
| Isoelectric point | 8.78 |
| Molecular weight | 52108.98 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | cell division GO:0051301 IEA:UniProtKB-KW
|
Interaction
Repeat regions
| Repeats |
>MDP06852
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.46| 13| 35| 379| 391| 1
---------------------------------------------------------------------------
379- 391 (23.67/12.20) QQQTQQQTQQQQG
417- 429 (26.79/14.62) QHQSHTMPHQQPG
---------------------------------------------------------------------------
|