<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06843
| Description |
Mediator of RNA polymerase II transcription subunit 15 (Fragment) |
| Sequence | VLQSLNQRPAQPINMPGMQNKMPGMGMMPSQTGGPMNHMGPIQSMQNNPMLTQMNQMGQGNIPPQMNQMVPGQMGQLGGQMQQNMQSQMQTQLPGQMTNQITGPIGNIQTSISQQMNQIGPGQLGPGQMQQQLNHIQRKPSEMMNTGFPGPRNVTPNQFLRQSPSPSAPSPAGLGAPSSNQMVASPALVPSPSPQHAIMTGPTRSVNSVGMAPSPSSSLNTPGGVGATPSPQQEDQAYRDKVRQLSKYIEPLRRMIAKMSSEGNVDKLSKMKKLLEILSNPSKRMPLDTLLKCEVVLEKLDFKRGDGSVGPPVTTLKEHQIFSPLLEAVSAHLQSPVINHTLQRTFGPCLDALFGPEIKNLPLPLKKQKIEESSSEIPDVLQGEIARLDQRFKVSLDPAQQSGSRCIQLICWLDDRHLPCVPPISVTVPADYPSTPPRCVMAPHEYEATTFLCAVQKALNIRIAKLPRRFSLSQLLDTWEMSVRQASAPKEMSITASTVLMGL |
| Length | 503 |
| Position | Tail |
| Organism | Trachymyrmex cornetzi |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Trachymyrmex.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.425 |
| Instability index | 66.39 |
| Isoelectric point | 9.38 |
| Molecular weight | 54780.85 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06843
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 137.74| 22| 22| 53| 74| 1
---------------------------------------------------------------------------
53- 74 (49.45/23.00) QM.NQMG...QGNIPPQMNQMVPGQM
76- 97 (24.46/ 7.21) ....QLGgqmQQNMQSQMQTQLPGQM
100- 124 (28.95/10.05) QItGPIG.niQTSISQQMNQIGPGQL
132- 152 (34.88/13.80) QL.NHI....QRKPSEMMNTGFPGPR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 109.15| 22| 22| 156| 177| 2
---------------------------------------------------------------------------
156- 171 (25.85/ 7.85) ..........PNQFLRQSPS..PSAPSP
172- 194 (29.06/ 9.71) AGLGAP...sSNQMV.ASPAlvPS.PSP
197- 222 (30.85/10.75) AIMTGPtrsvNSVGMAPSPS..SSLNTP
223- 236 (23.39/ 6.42) GGVGAT....P........S..PQQEDQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.01| 17| 22| 322| 342| 3
---------------------------------------------------------------------------
322- 342 (25.96/24.35) FSPLLEAvsahLQSPVI.NHTL
346- 363 (30.05/17.39) FGPCLDA....LFGPEIkNLPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.33| 20| 24| 247| 270| 4
---------------------------------------------------------------------------
247- 270 (28.01/27.62) KYIEPLRRMIAKMSsegnVDKLSK
273- 292 (32.32/20.17) KLLEILSNPSKRMP....LDTLLK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.40| 16| 20| 9| 28| 5
---------------------------------------------------------------------------
9- 28 (26.15/23.49) PAQ...PINMPG....MQNKmPgmgMM
29- 51 (25.24/ 9.83) PSQtggPMNHMGpiqsMQNN.P...ML
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.36| 10| 30| 398| 407| 7
---------------------------------------------------------------------------
398- 407 (19.62/10.38) PAQQSGS..RCI
429- 440 (15.74/ 6.96) PADYPSTppRCV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.30| 17| 77| 381| 397| 8
---------------------------------------------------------------------------
381- 397 (30.05/21.22) LQGEIARLDQRFKVS..LD
459- 477 (25.25/16.76) LNIRIAKLPRRFSLSqlLD
---------------------------------------------------------------------------
|