<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06841
| Description |
Mediator of RNA polymerase II transcription subunit 27 (Fragment) |
| Sequence | ISQGLSMEQLQTALTAIKVLRSNVGQVFDSLGNGLRAEHGEENKESKYLFELQELLTTVNVNLRDVEQAISCLNPPPGPFNLASTTYLSQETTQERQALYSTLVNSYKWTDKIHEYSNVAQSLLSQNSLKRSYTSSSRTKRGRYQTSNHNVPQAQVDSMISTFDRLFNDMTVSVSRPFASNAVLHVTLGHVLKAVIAFKGLMIERVVVKGYGETMDLWTESRHKVFRKVTENAHAAMLHFYSPTLPELAVRSFMTWFHSLINLFSEPCKRCGLYLHSALPPTWRDFRTLEPYHQECKP |
| Length | 298 |
| Position | Tail |
| Organism | Trachymyrmex cornetzi |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Trachymyrmex.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.352 |
| Instability index | 47.27 |
| Isoelectric point | 8.80 |
| Molecular weight | 33908.16 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP06841
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.18| 14| 26| 255| 269| 1
---------------------------------------------------------------------------
255- 269 (24.89/21.20) TW..FHSLiNLFSEPCK
282- 297 (25.29/16.19) TWrdFRTL.EPYHQECK
---------------------------------------------------------------------------
|