| Description | Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MWLQQYPMIENRTGPQTIEFLTKRVVALGAVQVGQFLVDCETYMSVPQLVLCLQSLTDSKLSSKFHVRAPVVVPASTRLLAQMAVAWPFKDAFRFLMLLFNICNFY |
| Length | 106 |
| Position | Head |
| Organism | Cyphomyrmex costatus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea> Formicidae> Myrmicinae> Cyphomyrmex. |
| Aromaticity | 0.12 |
| Grand average of hydropathy | 0.421 |
| Instability index | 62.07 |
| Isoelectric point | 8.96 |
| Molecular weight | 12118.26 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats | >MDP06839 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) APVVVP 2) MWLQQYPMI | 69 1 | 74 9 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab