<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06839
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MWLQQYPMIENRTGPQTIEFLTKRVVALGAVQVGQFLVDCETYMSVPQLVLCLQSLTDSKLSSKFHVRAPVVVPASTRLLAQMAVAWPFKDAFRFLMLLFNICNFY |
| Length | 106 |
| Position | Head |
| Organism | Cyphomyrmex costatus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Cyphomyrmex.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | 0.421 |
| Instability index | 62.07 |
| Isoelectric point | 8.96 |
| Molecular weight | 12118.26 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP06839
No repeats found
No repeats found
|