Description | Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MWLQQYPMIENRTGPQTIEFLTKRVVALGAVQVGQFLVDCETYMSVPQLVLCLQSLTDSKLSSKFHVRAPVVVPASTRLLAQMAVAWPFKDAFRFLMLLFNICNFY |
Length | 106 |
Position | Head |
Organism | Cyphomyrmex costatus |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea> Formicidae> Myrmicinae> Cyphomyrmex. |
Aromaticity | 0.12 |
Grand average of hydropathy | 0.421 |
Instability index | 62.07 |
Isoelectric point | 8.96 |
Molecular weight | 12118.26 |
Publications |
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP06839 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) APVVVP 2) MWLQQYPMI | 69 1 | 74 9 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab