<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06838
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MMKMTTIYTSKKQTKIESKGPRFEIGDFCVKLGSVTMSQNFKGVLVEVEYRPCVVPASAWELIREFLQGFLGSTVSNQAPQYLQNRMNEIYQPMDTIQQYLEHFGQYRKATGVNPSTTIGEVKQELYKLKKSLYVQRQSLRLDAKGKSLSDSETIKSLSLKAGGKLYYKDLGPQIGWKTVFLLEYAGPLVVYFWLYQRPWLFYGNVNTYNYHYVANCAAVAWSVHYVKRLLETIFVHRFSHATMPLRNLFKNCSYYWLFAMYVAYHTNHPLYTAPTKFEFYSGAVSFVMCELGNLSIHLALRNLRPSGTTVRKVPMPTKNPFTALFNYVSCPNYTYEIGSWISFTVMTSCLPAGLFTFAGAYQMTVWALSKHKAYKKEFLHYPKNRKAIIPFIL |
| Length | 394 |
| Position | Head |
| Organism | Cyphomyrmex costatus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Cyphomyrmex.
|
| Aromaticity | 0.15 |
| Grand average of hydropathy | -0.138 |
| Instability index | 36.38 |
| Isoelectric point | 9.58 |
| Molecular weight | 45501.41 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
| GO - Cellular Component | endoplasmic reticulum membrane GO:0005789 IEA:UniProtKB-SubCell
integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | oxidoreductase activity, acting on the CH-CH group of donors GO:0016627 IEA:InterPro
transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | lipid metabolic process GO:0006629 IEA:UniProtKB-KW
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06838
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 113.56| 32| 54| 178| 212| 1
---------------------------------------------------------------------------
178- 209 (61.72/36.92) KTVFLLEYAG...PLVV......YFWLYQRPWLFYGNVNTY
232- 272 (51.84/23.02) ETIFVHRFSHatmPLRNlfkncsYYWLFAMYVAYHTNHPLY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.94| 10| 15| 138| 147| 2
---------------------------------------------------------------------------
138- 147 (17.69/11.32) QSLRLDAKGK
156- 165 (17.25/10.90) KSLSLKAGGK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.92| 17| 19| 81| 97| 4
---------------------------------------------------------------------------
81- 97 (33.24/22.87) QYL....QNRMNEIYQPMDTI
99- 119 (25.68/16.14) QYLehfgQYRKATGVNPSTTI
---------------------------------------------------------------------------
|