<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06837
| Description |
Mediator of RNA polymerase II transcription subunit 15 (Fragment) |
| Sequence | DEAVQVSGMPTTKNSIEMENHVFQKAKSKEEYLGFVARLILHVREMNSKKGATDNAPGTAGTNNQGMPDPIGALQTLARQGTGNNQMMSIGGPGPNHQGMIPQSPANTATNLLQSLNQRPAQPMNMPGMQNKMPGMGMMPSQTGGPMNHMGPIQTIQNNPMLTQMNQMGQGNIPPQINQMVPGQMGQLGAGQMQQNMQSQMQTQLPGQMNNQITGPISNIQTSIPQQMNQIGSGQLGPGQIQQQLNHIQRKPGEIMNTGFPGPRNVTPNQFLRQSPSPSAPSPAGLGAPSSNQMVASPALVPSPSPQHAILTGPTRSVNSVGMAPSPSSSLNTPGGVGATPSPQQEDQAYRDKVRQLSKYIEPLRRMIAKMSSEGNVDKLSKMKKLLEILSNPSKRMPLDTLLKCEVVLEKLDFKRGDGSVGPPLKEHQIFSPLLEAVSAHLQSPVINHTLQRTFGPCLDALFGPEIKNLPPPLKKQKIEESPSEIPDVLQGEIARLDQRFKVSLDPAQQSGSRCIQLICWLDDRHLPCVPPISVTVPADYPSTPPRCVMAPHEYEATTFLCAVQKALNVRIAKLPRRFSLSQLLDTWEMSVRQASAPKEMSITASTVLMGL |
| Length | 612 |
| Position | Tail |
| Organism | Cyphomyrmex costatus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Cyphomyrmex.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.474 |
| Instability index | 60.41 |
| Isoelectric point | 9.29 |
| Molecular weight | 66213.47 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06837
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
6| 340.14| 50| 50| 167| 216| 1
---------------------------------------------------------------------------
64- 116 (47.53/13.12) NQGM........PDP.IGAL..........QTLAR...Q..GT.GNNQmmsIGGP.....gPN.HQGMIPqspantatnllQSL
117- 155 (50.24/14.25) NQR.........PAQpM...........NMPG.MQNKMPgmGM.MPSQ...TGGP....mnHM.G....P...........IQT
178- 228 (88.29/30.19) NQMV........PGQ.MGQLGAGQMQ.QNMQSQMQTQLP..GQ.MNNQ...ITGP....isNI..QTSIP...........QQM
229- 268 (56.25/16.77) NQI..........GS..GQLGPGQIQ.QQL.NHIQRK.P..GEiMN.......TG......FP.GPRNVT...........P..
269- 329 (53.32/15.54) NQFLrqspspsaPSP.AG.LGAPSSN.QMVASPALVPSP..SP.QHAI...LTGP.trsvnSV.GMA..P..........sPSS
330- 380 (44.50/11.85) SLNT........PGG.VGATPSPQQEdQAYRDKVR.QLS.......KY...IE.PlrrmiaKMsSEGNV............DKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.92| 22| 47| 412| 455| 2
---------------------------------------------------------------------------
412- 433 (42.36/53.93) LD..FKRGDGSVGPPLKEHQIF.SP
459- 483 (32.56/ 6.75) LDalFGPEIKNLPPPLKKQKIEeSP
---------------------------------------------------------------------------
|