<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06836
| Description |
Mediator of RNA polymerase II transcription subunit 28 |
| Sequence | MRFIDLARQMEAFFLQKRFLLSALKPEMLVKEEINELKLELARKEELIKRHNDKIAVWQNMLSDLQGWAQSPAQGPAPSGLPNGNQSGQNQQATGGGGNASIQQQQQILQHQQQLQQQLQQQQQQQQHPQLQQQLQQQMQHSLQPQVQQGSGGPPTSGLQGVGVPVNQQGMFMAQGGVGGRATGFPVGGMGSSALQGPLAYLEKTTSNIGMPERRS |
| Length | 216 |
| Position | Head |
| Organism | Cyphomyrmex costatus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Cyphomyrmex.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.732 |
| Instability index | 80.24 |
| Isoelectric point | 9.45 |
| Molecular weight | 23692.46 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP06836
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.18| 12| 14| 110| 122| 1
---------------------------------------------------------------------------
110- 122 (20.91/11.09) QHqQQLQQQLQQQ
127- 138 (25.28/ 9.53) QH.PQLQQQLQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 96.49| 27| 76| 61| 92| 2
---------------------------------------------------------------------------
61- 88 (48.76/22.21) MLSDLQGWAQSPAQGPAPSGLpNG.....NQSG
139- 170 (47.73/12.71) MQHSLQPQVQQGSGGPPTSGL.QGvgvpvNQQG
---------------------------------------------------------------------------
|