<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06825
Description |
Mediator of RNA polymerase II transcription subunit 27 |
Sequence | MEQLQTALTAIKVLRSNVGQVFDSLGNGLRAEHGEENKESKYLFELQELLTTVNVNLRDVEQAISSLNPPPGPFNLASTTYLSQETTQERQALYSTLVNSYKWTDKIHEYSNVAQSLLSQNSLKRSYTSSSRTKRGRYQTSNHNVPQTQVDSMISTFDRLFNDMTVSVSRPFASNAVLHVTLGHVLKAVIAFKGLMIERVVVKGYGETMDLWTESRHKVFRKVTENAHAAMLHFYSPTLPELAVRSFMTWFHSLINLFSEPCKRCSLYLHSALPPTWRDFRTLEPYHQECKP |
Length | 292 |
Position | Tail |
Organism | Cyphomyrmex costatus |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Cyphomyrmex.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.390 |
Instability index | 46.00 |
Isoelectric point | 8.87 |
Molecular weight | 33366.49 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions