<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06825
| Description |
Mediator of RNA polymerase II transcription subunit 27 |
| Sequence | MEQLQTALTAIKVLRSNVGQVFDSLGNGLRAEHGEENKESKYLFELQELLTTVNVNLRDVEQAISSLNPPPGPFNLASTTYLSQETTQERQALYSTLVNSYKWTDKIHEYSNVAQSLLSQNSLKRSYTSSSRTKRGRYQTSNHNVPQTQVDSMISTFDRLFNDMTVSVSRPFASNAVLHVTLGHVLKAVIAFKGLMIERVVVKGYGETMDLWTESRHKVFRKVTENAHAAMLHFYSPTLPELAVRSFMTWFHSLINLFSEPCKRCSLYLHSALPPTWRDFRTLEPYHQECKP |
| Length | 292 |
| Position | Tail |
| Organism | Cyphomyrmex costatus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Hymenoptera> Apocrita> Aculeata> Formicoidea>
Formicidae> Myrmicinae> Cyphomyrmex.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.390 |
| Instability index | 46.00 |
| Isoelectric point | 8.87 |
| Molecular weight | 33366.49 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions