Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MADQEPHSLASTFPNPPPFWHDFTPDKLGRIEKLRSELVDEEAAEEATPLRVPNLPDDLTNLQAPPEPADGRWRVFGDQYMLDDKLPTLEDQGITNLHAAANESQQQQLQDKDGKHYDRALELKKLSKSLLLNFLELVGVMSHNPADGEAKVKDLRTLFINLHHILNEYRPHQARESAIEMMQDHLDRTRAETAAIRTQVDKARSVLEGLGSLDTADEKPVAFAGEEPVDWDGLARQRDADLWAATDAACAS |
Length | 252 |
Position | Middle |
Organism | Drechmeria coniospora |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Drechmeria. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.676 |
Instability index | 49.49 |
Isoelectric point | 4.74 |
Molecular weight | 28242.11 |
Publications | PubMed=26975455 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP06813 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 51.11| 15| 71| 101| 119| 2 --------------------------------------------------------------------------- 101- 119 (23.17/21.90) ANESQQQQLQDkdgkHYDR 174- 188 (27.94/15.57) ARESAIEMMQD....HLDR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) RIEKLR 2) RWRVFGDQY | 30 72 | 35 80 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab