<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06809
Description |
"Mediator complex, subunit Med21/Med9" |
Sequence | MGDRLTQLQDAVDQLAQQFVACLHFVHRRHDLKTLGPNDRVRDIKQDPHQKEVDPLPAEEFRPGLRELSRDLVVKEQQIEYLISSLPGLDNSEKDQERCIKDLEEELKAAEVQRLEALKERDRILAELDSVIRSVRRP |
Length | 138 |
Position | Middle |
Organism | Drechmeria coniospora |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Drechmeria.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.782 |
Instability index | 56.51 |
Isoelectric point | 5.29 |
Molecular weight | 16084.03 |
Publications | PubMed=26975455
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | RNA polymerase II repressing transcription factor binding GO:0001103 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IEA:EnsemblFungi
transcription corepressor activity GO:0003714 IEA:EnsemblFungi
|
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP06809
No repeats found
|