<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06808
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDKYIDNRFERLEKALSNLIDSVTKYHPSIAQAQELKAADDDLTSGLEEVQIHQNNHLRILQLRQSSAALDSQIRETLTSLAATRKDIVTTHTTDYPALPNYAIRYEELLSYARRISKTTLPPAATISAAADVAAATGASPTPDAQTPAPDSQPQSAVTPSAGTPSRLQSPVTNGPSQPQTQQTMTSTNTTLPEGMSQYLNPLSGQLFFPWPLEEKIRSGALASNQILAEQGIDPKGYDPVTEEERKRSEEEERKAKEEQENREREVREKQMREEREKLRLERERQREREQEAWRRASVIGQARSDGTSLARPKAGAGEKKQFQFTNLDDLDDDDDDEEN |
Length | 340 |
Position | Middle |
Organism | Drechmeria coniospora |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Drechmeria.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.995 |
Instability index | 58.70 |
Isoelectric point | 4.95 |
Molecular weight | 38129.47 |
Publications | PubMed=26975455
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP06808
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.63| 21| 29| 245| 273| 1
---------------------------------------------------------------------------
245- 265 (34.87/26.36) ERKRSE.EEERKAKEEQENRER
275- 296 (32.76/10.74) EREKLRlERERQREREQEAWRR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 73.04| 19| 22| 141| 159| 2
---------------------------------------------------------------------------
122- 141 (18.13/ 6.29) .PP.AATisAAAD..VAAATGASP
142- 160 (36.75/19.65) TPD.AQT..PAPD..SQPQSAVTP
164- 184 (18.16/ 6.30) TPSrLQS..PVTNgpSQPQTQQT.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.40| 16| 29| 74| 94| 3
---------------------------------------------------------------------------
74- 94 (18.03/25.06) IR.ETLTSLAatRKdivTTHTT
104- 120 (23.36/13.71) IRyEELLSYA..RR...ISKTT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.03| 13| 29| 27| 39| 4
---------------------------------------------------------------------------
27- 39 (21.78/15.33) HPSIAQAQELKAA
57- 69 (21.24/14.76) HLRILQLRQSSAA
---------------------------------------------------------------------------
|