<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06799
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MYQLFLTATVEEGDFQAACAVLGGFCAMAPWQTVDRVLYFQGPPRPTGMSNQNSIEKPMRKDVAFLYKDLHQNLSRQSFILQARYDVSKDRHMGPQAEPLDLETSAGILRWNDFPDPPRGIPLLMQRKLVELWEQKNLPSVMRDNHYRQVPPRAVINTSTEIIEEVYRFFRDDVEFCFTRQFFLKPIEEYTPLEGRQQAQAKPLATLPSWDALTPVDMQNRWMLQVKVHVLQDNKPDEIRKAQEQLVSIRGELDGVFDFKAIDRRVHDTRVAMQQQGIQELPQKVMLGKT |
| Length | 290 |
| Position | Head |
| Organism | Drechmeria coniospora |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Ophiocordycipitaceae> Drechmeria.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.507 |
| Instability index | 48.31 |
| Isoelectric point | 6.25 |
| Molecular weight | 33692.26 |
| Publications | PubMed=26975455
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06799
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.76| 11| 31| 108| 118| 1
---------------------------------------------------------------------------
108- 118 (23.97/14.30) ILRWNDFPD.PP
141- 152 (18.79/ 9.73) VMRDNHYRQvPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 111.69| 34| 102| 65| 100| 2
---------------------------------------------------------------------------
65- 100 (52.82/43.37) FLYKDLHQNLSRQsFILQA..RYDVSKDRHmGPQAEPL
169- 204 (58.87/38.27) FFRDDVEFCFTRQ.FFLKPieEYTPLEGRQ.QAQAKPL
---------------------------------------------------------------------------
|