<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06789

Description Uncharacterized protein (Fragment)
SequenceMDNRPALSANPRPPPLHRAVSGGGLPFAKPASRPSLPARLSTARSVSQPTKVVDLTTDAPARGDKSRSSLFGNGDGVVSSPGVIEVSGEEDEPQAKRAKVGSADGGWEKERDGDFQDPAHRTAPGSPLPTLPKVNTSLTRGLLARVPRHGGESPLRKAHDLEPPAMATKLPPPKNVADFSPWKGHHPEDVLNEAVVKTGYCDKGPVSIQMECMSAKPSIWQNLSSKNNMGLQTLSWLFAQVMDKRQALGKCTAPSTFKPPPRVTVTDTKREAWLRDLANPDIPLRKQSRTIPHGIRGKLLMDQCLGKEIPLQRAVWLAKCVGANELRAFRRKGVSGTVAVTNEQKWVSDWTVQVEQFLEGVIEQCGQPDWQPRITYA
Length377
PositionKinase
OrganismAcidomyces richmondensis BFW
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Teratosphaeriaceae> Acidomyces> unclassified Acidomyces.
Aromaticity0.05
Grand average of hydropathy-0.577
Instability index51.35
Isoelectric point9.56
Molecular weight41041.33
Publications
PubMed=26973616

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
ECO:0000256	ARBA:ARBA00002895
ECO:0000256	ARBA:ARBA00003744
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP06789
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.11|      15|      24|     241|     264|       1
---------------------------------------------------------------------------
    1-   15 (32.83/ 8.37)	MDNRPALS..ANP...RPPP
  242-  261 (21.28/24.45)	MDKRQALGkcTAPstfKPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.42|      23|      31|      46|      76|       2
---------------------------------------------------------------------------
   32-   57 (29.09/ 8.85)	SRPSLparLSTARSVSQPTKVVDLTT
   66-   88 (38.33/31.60)	SRSSL...FGNGDGVVSSPGVIEVSG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      77.98|      23|      24|     264|     286|       3
---------------------------------------------------------------------------
  264-  286 (40.24/23.02)	TVTDTKREAWLRDLA.NPDIPLRK
  290-  313 (37.74/21.21)	TIPHGIRGKLLMDQClGKEIPLQR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.21|      18|      36|     111|     131|       6
---------------------------------------------------------------------------
  111-  129 (31.72/22.37)	RDGDfQDP...AHRTAP...GSPLP
  148-  171 (24.49/ 7.06)	RHGG.ESPlrkAHDLEPpamATKLP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP06789 with Med12 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MDNRPALSANPRPPPLHRAVSGGGLPFAKPASRPSLPARLSTARSVSQPTKVVDLTTDAPARGDKSRSSLFGNGDGVVSSPGVIEVSGEEDEPQAKRAKVGSADGGWEKERDGDFQDPAHRTAPGSPLPTLPKVNTSLTRGLLARVPRHGGESPLRKAHDLEPPAMATKLPPPKNVADFSPWKGHHPE
1
188










Molecular Recognition Features






MoRF SequenceStartStop




1) LPARLSTAR
2) LRKAHDL
36
155
44
161