<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06783
Description |
Mediator of RNA polymerase II transcription subunit 7 (Fragment) |
Sequence | ALFPAPPPFYKYFTKQNIAELKRLREQAGPPPDGKQTEQDGSSIKPDLDILSLPTELRFLIPPPPPTDGKFQSFGICHNPNGPPPSLQDLQVEQLYPSHPGVKLNPQTYLISLAKSQLLTFLGLVGALSQNAEKYDTFTRDLETITSNMHDLVNQYRPHQARESLISMMKERVEKMRAEIKAIAEAKARARKLMEAL |
Length | 197 |
Position | Middle |
Organism | Acidomyces richmondensis BFW |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Teratosphaeriaceae> Acidomyces>
unclassified Acidomyces.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.528 |
Instability index | 56.92 |
Isoelectric point | 8.62 |
Molecular weight | 22132.21 |
Publications | PubMed=26973616
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060
ECO:0000256 ARBA:ARBA00003669
|
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP06783
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 85.00| 18| 31| 24| 41| 1
---------------------------------------------------------------------------
24- 41 (35.99/16.05) LREQAGPPP..DGK..QTEQDG
57- 75 (27.46/10.85) LRFLIPPPPptDGK...FQSFG
77- 94 (21.55/ 7.25) CHNPNGPPP..SLQdlQVEQ..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.76| 15| 18| 143| 157| 3
---------------------------------------------------------------------------
143- 157 (26.58/19.28) ETITSNMHDLVNQYR
163- 177 (25.18/17.98) ESLISMMKERVEKMR
---------------------------------------------------------------------------
|