<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06774
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MAGTPDASMEEILWRSPPHVQMMGGYLHSNNILFYFAESPFFDPTSNNASLAIQANYNEAFRHFVETREAFEGRLKTMQGLEFVVSYDPIQAAAQPDGRFAHEPSNIWVIRKQNRRKRTGLEDEVVVLSTYFIVGDCIYMAPSVASVVGNRILSAVTSLTSLLKTASTLPTFTPSHGHTYMPPALKQADASQPGTQSQQSKENTPLPDADAAGKASLVGSSQVVGTGSNLQDTRTLAESFNLLRRYGEEFMDEHPLVGEPGSFILSRVNDTDRTSAAKPPAPAAKVGTPQVRVDTPGKVSEKGATPSGSEENKMRKKKTKVGN |
| Length | 323 |
| Position | Head |
| Organism | Aspergillus luchuensis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.447 |
| Instability index | 47.89 |
| Isoelectric point | 6.67 |
| Molecular weight | 35120.05 |
| Publications | PubMed=27651094
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06774
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 163.41| 45| 82| 190| 234| 1
---------------------------------------------------------------------------
113- 167 (31.31/11.91) .........................QNRRKRTGLEDEVvvlstyfivgdciymAPSVASVVGNrilSAVTSLTSLLKTAS
190- 234 (74.99/36.26) ASQPGT.................QSQQSKENTPLPDAD...............AAGKASLVGS...SQVVGTGSNLQDTR
257- 315 (57.11/26.29) VGEPGSfilsrvndtdrtsaakpPAPAAKVGTPQVRVD...............TPGKVSEKGA...TP...SGSEENKMR
---------------------------------------------------------------------------
|