<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06762
| Description |
Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MADILTQLQTCLDQLATQFYATLCYLTTYHDNIPATPPPTTTTPSAAPLLAKIPKNASTPPVPASAPQAAQSQSQASPPPPDSTNPPGQGPNADNQQQQNADGTAEGLPAPDSPATFAARQRELARDLVIKEQQIEYLISVLPGIDSSEAEQERRIRELEGELRVVEGVREERRRELGVLRKRLEGVLGVVERGIYSRG |
| Length | 199 |
| Position | Middle |
| Organism | Aspergillus luchuensis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.573 |
| Instability index | 72.04 |
| Isoelectric point | 4.93 |
| Molecular weight | 21528.82 |
| Publications | PubMed=27651094
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP06762
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 72.83| 17| 18| 152| 169| 1
---------------------------------------------------------------------------
131- 145 (23.05/14.59) KEQQIEYL...IS.VLPGI
152- 169 (25.97/22.53) QERRIRELeGELR.VVEGV
171- 187 (23.80/15.27) EERR.REL.GVLRkRLEGV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 86.07| 20| 21| 56| 75| 2
---------------------------------------------------------------------------
36- 58 (26.55/ 9.55) TPPptttTPSAAPLLAKI.PKNAS
59- 78 (36.20/15.31) TPP....VPASAPQAAQSQSQASP
79- 99 (23.32/ 7.62) PPPdstnPPGQGPNADNQQQQ...
---------------------------------------------------------------------------
|