<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06759

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMPGVVMDNANIGGLRHGPGNTYPQDGLSHPRGEVAQINGANAQDGPVHVNGVEKNASQTRGAEIVSANHASRVTKGPPELPHITQGFFPFAKLVNRSVQQCWNDLSDLITEMAEMQVNSHEFHPSTAPTTGKSPGNQSPGNIRKKLRILEFSHAKRAEFIKLLVLSQWSRQAADVSKLIDIQNFIRTRHQAYMNALQWVGDMKRDLVQAQVANPDLKTALEVLSRGKVASMSDLGYKPPRRLTVRGTLRKLQKINRLIGARLVVQEEIPPPFRNYRVHDGRVTFSVPGEFELDLSIGEENENSQFFFVDIRFLFSPSPPVLKGRLLNELEMTINDVLQNSGLTGCFDLLHNLVLTNKVNTLFKQATELARGSWSEGLRVELLHRTLVVQYWTLKPGAKSWLEIGIRRGHRKSDSESPGLPSLKFRWMRDGGEVPCEDIAFDAENLSMEIVLRSVIALHVSHILSSAYNKIRQSSLFSTGFLSLRAHLTRIEPGDCQLDAQLTETRHLRVSIEPMSGMSILSATPTVSDRSDLERNPERSSVEDIVSRVARIRCNAAIEEIESKVKMLGFVPLNPRAWKVDIRRIFPPNVLRFTLFSHQLWGRNWIVAATSSMDGDSWWVVQLRPTVPAKGPPVPHGSGRGQSVLRSAQVVTDSFFPARYDMDDAYLANLGHSLSGILAIHSNARYLSDLQSIKFHPPPHKLKVEPDLRVPDILVRYDVSTLPSVFRAAMPIKAKKKSLIRDTIRLAFHGVDPREKCAIMVAYGNLVDSTATLGPLISSWDRSLVFQKGGSGFAMRLLAPAGHPVIASLLENLQRLECVLSVLESLQRKKVEIRTFSLSSISFVYGPERDLAASLNIHLSRNESLMELSPTELASRSESLFGLRLGIQFGLQNPHRRIQESLASSLNRSSTEAGLETVVELLTLTLPLMRALDQLMANTSYSGPLRLHVTVRNARTYQIHYPGDEARFQLVAASHQNRSVWVLKDANSQGNSKNDDSITARLRQTLYTSKGDGWKGLETGVVAEVNKVGNLLRELEKCFAASRADPKHDPADSAANFNGSNNPGTSASETEKGTADGAKFSLSDPLTTLPNDKSNLSQADTAAQKEDIIMID
Length1111
PositionTail
OrganismAspergillus luchuensis
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
Aromaticity0.06
Grand average of hydropathy-0.294
Instability index45.64
Isoelectric point9.20
Molecular weight123150.97
Publications
PubMed=27651094

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	ARBA:ARBA00003669
ECO:0000256	RuleBase:RU365082
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP06759
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     106.26|      27|      30|     875|     901|       1
---------------------------------------------------------------------------
  835-  854 (25.03/11.68)	.....FSLS.SIS.F.VYGPERDLAASL
  875-  901 (46.35/27.53)	RSESLFGLRLGIQ.FGLQNPHRRIQESL
  907-  934 (34.88/19.00)	RSSTEAGLETVVElLTLTLPLMRALDQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.52|      19|      30|      28|      46|       2
---------------------------------------------------------------------------
   28-   46 (35.70/21.12)	SHPRG.EVAQINGAN.AQDGP
   57-   77 (24.82/12.60)	SQTRGaEIVSANHASrVTKGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.31|      25|      30|     141|     168|       3
---------------------------------------------------------------------------
  141-  168 (36.40/30.83)	NIRKKLRILEFSHAKRAEFIKLLvlsQW
  174-  198 (43.91/28.91)	DVSKLIDIQNFIRTRHQAYMNAL...QW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.77|      19|      34|     684|     702|       4
---------------------------------------------------------------------------
  684-  702 (36.19/22.03)	RY.LSDLQSIKFHPPPHKLK
  715-  734 (26.58/14.28)	RYdVSTLPSVFRAAMPIKAK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.36|      13|      34|     291|     303|       5
---------------------------------------------------------------------------
  291-  303 (21.46/14.21)	ELDLSIGEENENS
  328-  340 (21.90/14.65)	ELEMTINDVLQNS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      87.08|      25|      34|    1025|    1049|       6
---------------------------------------------------------------------------
 1025- 1049 (44.20/30.34)	NKVGNLLRELEKCFAASRADPKHDP
 1060- 1084 (42.88/29.20)	NNPGTSASETEKGTADGAKFSLSDP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.74|      18|      34|     601|     618|       8
---------------------------------------------------------------------------
  601-  618 (35.59/23.10)	GRNWIVAATSSMDGDSWW
  638-  655 (30.14/18.45)	GRGQSVLRSAQVVTDSFF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP06759 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) FAASRADPKHDPADSAANFNGSNNPGTSASETEKGTADGAKFSLSDPLTTLPNDKSNLSQADTAAQK
2) VMDNANIGGLRHGPGNTYPQDGLSHPRGEVAQINGANAQDGPVHVNGVEKNASQTRGAEIVSANHASRVTKGPPE
1038
5
1104
79










Molecular Recognition Features






MoRF SequenceStartStop




1) KEDIIMI
1104
1110