<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06750
| Description |
Mediator of RNA polymerase II transcription subunit 25 (Fragment) |
| Sequence | GVLEWQEKPKPASVDANTKLTRSLPCQVYVNHGENLKTEQWPQKLIMQLIPQQLLTTLGPLFRNSRMVQFHFTNKDLESLKGLYRIMGNGFAGCVHFPHTAPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNGIRQVITNHKQVQQQKLEQQRGLRAPQPQPQGAVGASAATGQPQPQGATQAPTGAPQGPPGAAPGPPPSGPIL |
| Length | 205 |
| Position | Unknown |
| Organism | Mus musculus (Mouse) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae>
Murinae> Mus> Mus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.431 |
| Instability index | 34.75 |
| Isoelectric point | 9.82 |
| Molecular weight | 22372.57 |
| Publications | PubMed=19468303
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP06750
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.97| 21| 24| 156| 179| 1
---------------------------------------------------------------------------
156- 179 (34.48/18.57) RAPQPQPQGAVGasAATGqPQPQG
182- 202 (44.49/16.32) QAPTGAPQGPPG..AAPG.PPPSG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.46| 18| 24| 55| 72| 2
---------------------------------------------------------------------------
55- 72 (33.81/22.11) LTTLGPLFR...NSRMVQFHF
77- 97 (28.65/17.81) LESLKGLYRimgNGFAGCVHF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 65.99| 25| 74| 25| 51| 3
---------------------------------------------------------------------------
25- 40 (23.52/10.27) ...........................................................PC...........QVYVNHG..ENLKTEQ
43- 115 (15.35/ 9.57) QKLIMQLIPqqllttlgplfrnsrmvqfhftnkdleslkglyrimgngfagcvhfphtaPC...........EVRVLM....LLYSSK
116- 151 (27.12/ 9.98) KKIFMGLIP....................................................ydqsgfvngirQVITNHKqvQQQKLEQ
---------------------------------------------------------------------------
|