<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06746
| Description |
Prostate tumor-overexpressed gene 1 protein homolog (Fragment) |
| Sequence | PRPEPNSRSKRWLPSHVYVNQGEILTDQWPRRLFMQLIPQQLLTTLVPLFRNSRLVQFHFTKDMETLKSLCRIMDNGFAGCVHFSYKASCEVRVLMLLYSSEKKIFIGLIPHDQSNFVNGIRRVIANQQQVLQRSL |
| Length | 136 |
| Position | Unknown |
| Organism | Mus musculus (Mouse) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae>
Murinae> Mus> Mus.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.235 |
| Instability index | 51.10 |
| Isoelectric point | 10.11 |
| Molecular weight | 15956.47 |
| Publications | PubMed=19468303
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP06746
No repeats found
No repeats found
|