<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06746
Description |
Prostate tumor-overexpressed gene 1 protein homolog (Fragment) |
Sequence | PRPEPNSRSKRWLPSHVYVNQGEILTDQWPRRLFMQLIPQQLLTTLVPLFRNSRLVQFHFTKDMETLKSLCRIMDNGFAGCVHFSYKASCEVRVLMLLYSSEKKIFIGLIPHDQSNFVNGIRRVIANQQQVLQRSL |
Length | 136 |
Position | Unknown |
Organism | Mus musculus (Mouse) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae>
Murinae> Mus> Mus.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.235 |
Instability index | 51.10 |
Isoelectric point | 10.11 |
Molecular weight | 15956.47 |
Publications | PubMed=19468303
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP06746
No repeats found
No repeats found
|