<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06742
Description |
Mediator of RNA polymerase II transcription subunit 25 (Fragment) |
Sequence | XVDCAPESYVQCHAPTSSAYEFVTWLDGINLSLLPANGIPRKLSSGIVKCRCLLRTSGRNPHLEFWEAPRPSLLHIRDGAYEDSTTFGQMFMGGGGESCSLIAEGLSTALQLFDDFKKMREQIGQTHRVCLLICNSPPYLLPAVESTTYSGCTTESLVQKIGER |
Length | 164 |
Position | Unknown |
Organism | Mus musculus (Mouse) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae>
Murinae> Mus> Mus.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.131 |
Instability index | 46.32 |
Isoelectric point | 5.79 |
Molecular weight | 17903.25 |
Publications | PubMed=19468303
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP06742
No repeats found
|