<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06716

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMDQHRVTASQDLKKDRSQPKEGQLPQKRDFAQMQTSQPNGTHAQNGPHPNGVPVQAPPATNGQISNANTTANLPTPPPLDGSWRDEPVNKSLGTLIERLAQQCFGDLNDTLTKMAETSTASGAQTNGVLPHTTDTNEASLSKKRLLMDFASNQRDRFIKTLILSDWARDAEEIARLIDIQLWAARQADAQRFAINFFYSTKQDMRVAKMPNPNIEAALELLSTGKTSRFPDLGYLPPKRLSAKQLLKTLKGMNVALIERLNLHEDLPPYFNDFSVANGRATFRVPDEFEVDVSVADEDPSTPFYFIDIRFLFAPTPSLSDDGLRMHLEERVNAALASSGLQGCYDFLHRYVLAHKINALRAQASKLLRDKWFDCLQPEMHRQVFTLQYWRGQRAAKSWIELGISSGKQKGAKSRRPPTPRNSFRWFRQGQEVKDHNIDIDWQNLDLASTLASVTAKHTQWLLHSIKERFDILAGQNSQVDAQLKTSDTDPDDCQLAFSLAGLPKPIVTRFEPITGRISVSPPNRNAQQAEKFINGTANADAGRALAEVLARSVQDRLIPMADAAGWTSVDQSRIVVPPATKAMLGADAIRRSLYKCSQGWGDAWALYVHFGLEGEKWFVVRIQESIEQGRPVRFMSTARRLNLPSTLANLTQASLRHIQEVAEAEVSFAVLIQELNDSRLEYRIESTSSLTKRGADSEPGLAIYFSMNTPTKPSGSKASLLPFKLASWIRLIPSTLTNVEDGVAEVRHDVRFTVDPSKFQHLSEHLTNSTRKSDIAMNDSGALGLKVNVPFGKPYFAMIQRRLTHCDRLNYYLELLKQFGYRCTDVGLDVLSFVYSDVHDLAAQITFDKNAAQSAKLKLSPINSNPHQRIRVALEKSYNRAKNRGLTQLAWDLRVTLPLLRLFDKLESAESSGESASVYTRDVHRYTLTYKAPLPACSFAISVQRGQSQIPGPTGVQFRCKPEAALGDDALSHALREFSKGDGHEWFGDHVGGFGAGLAGLDEAFTKLDQAIRKCEGAVVKKQGTPAEHVTPAPNSTMQRTQSQQRPSAQPRKQSRNSHKQEVIELD
Length1067
PositionTail
OrganismPseudocercospora eumusae
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Pseudocercospora.
Aromaticity0.08
Grand average of hydropathy-0.481
Instability index40.28
Isoelectric point9.00
Molecular weight118947.08
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU365082

GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP06716
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.67|      14|      15|     108|     121|       1
---------------------------------------------------------------------------
  108-  121 (22.94/14.65)	NDTLTKMAETSTAS
  126-  139 (24.73/16.37)	NGVLPHTTDTNEAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.27|      13|      15|     552|     564|       3
---------------------------------------------------------------------------
  552-  564 (23.59/16.38)	SV.QDRLI.PMADAA
  568-  582 (14.68/ 7.04)	SVdQSRIVvPPATKA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.81|      15|      17|      57|      73|       4
---------------------------------------------------------------------------
   57-   71 (27.94/ 9.65)	PPATNGQISN..ANTTA
  521-  537 (22.87/ 6.12)	PPNRNAQQAEkfINGTA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      77.20|      25|     160|     629|     668|       5
---------------------------------------------------------------------------
  631-  657 (39.60/21.97)	PVRFMSTARRlnLPSTLANLTQ..ASLRH
  722-  748 (37.59/12.25)	PFKLASWIRL..IPSTLTNVEDgvAEVRH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.72|      11|     103|     140|     150|       8
---------------------------------------------------------------------------
  140-  150 (18.24/12.98)	LSKKRLLMDFA
  157-  167 (19.49/14.42)	FIKTLILSDWA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.29|      18|     237|      74|      92|      12
---------------------------------------------------------------------------
   74-   91 (37.15/23.52)	PTPPPLDGSWR...DEPVNKS
  314-  334 (27.14/10.49)	PTPSLSDDGLRmhlEERVNAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      95.77|      29|     126|     668|     696|      13
---------------------------------------------------------------------------
  668-  696 (47.30/35.54)	FAVLIQELND.SRLEYRIESTSSLTKRGAD
  796-  825 (48.47/36.62)	FAMIQRRLTHcDRLNYYLELLKQFGYRCTD
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP06716 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) EGAVVKKQGTPAEHVTPAPNSTMQRTQSQQRPSAQPRKQSRNSHKQEVIELD
2) MDQHRVTASQDLKKDRSQPKEGQLPQKRDFAQMQTSQPNGTHAQNGPHPNGVPVQAPPATNGQISNANTTANLPTPPPLDGSWRDEPV
1016
1
1067
88










Molecular Recognition Features






MoRF SequenceStartStop




NANANA