<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06711
Description |
Uncharacterized protein |
Sequence | MSTNEFQALQAQIGSVLSSLSQNAPPSWPDMLSALNILTHKVTTLASEIEKPTNGQILVYPLTSDERVFETLLRTKLHPEVEADTEAQLQGPEWESSQLERAVANQNELVLRALSAFEEYRQQLVDKVRTEPPRQKPMGQGNISSNQLTEVLRVVNGSTP |
Length | 160 |
Position | Head |
Organism | Gonapodya prolifera (strain JEL478) (Monoblepharis prolifera) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Chytridiomycota>
Chytridiomycota incertae sedis> Monoblepharidomycetes> Monoblepharidales>
Gonapodyaceae> Gonapodya.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.465 |
Instability index | 45.05 |
Isoelectric point | 4.85 |
Molecular weight | 17793.77 |
Publications | PubMed=25977457
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP06711
No repeats found
|