<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06711
| Description |
Uncharacterized protein |
| Sequence | MSTNEFQALQAQIGSVLSSLSQNAPPSWPDMLSALNILTHKVTTLASEIEKPTNGQILVYPLTSDERVFETLLRTKLHPEVEADTEAQLQGPEWESSQLERAVANQNELVLRALSAFEEYRQQLVDKVRTEPPRQKPMGQGNISSNQLTEVLRVVNGSTP |
| Length | 160 |
| Position | Head |
| Organism | Gonapodya prolifera (strain JEL478) (Monoblepharis prolifera) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Chytridiomycota>
Chytridiomycota incertae sedis> Monoblepharidomycetes> Monoblepharidales>
Gonapodyaceae> Gonapodya.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.465 |
| Instability index | 45.05 |
| Isoelectric point | 4.85 |
| Molecular weight | 17793.77 |
| Publications | PubMed=25977457
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP06711
No repeats found
|