<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06699
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MEDDETELQNPFPSPPSHYTKYTNHNLKLLSLLHDRTGDDAPNANQREILSDQADVPDWQLTQLEKPRVDWILDEPEAYYDVFGDRWFVKDKVLSLGDAGGNQLYPSDPTIDRRPALRSILRSLLVTYSSLMSSLLLPPPLSPDEPPEWHRHVDWISNLSTNLMAAANDLRPVQARGNLESMMRRQLELRREETKVLHEKCNVLEEKLRDIRSSVTNLPASQTSLTMAPKTLHDETTIPWDSQSIQDDVQLTEIDVLLWAEQMR |
Length | 264 |
Position | Middle |
Organism | Leucoagaricus sp. SymC.cos |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Agaricaceae> Leucoagaricus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.665 |
Instability index | 62.95 |
Isoelectric point | 4.76 |
Molecular weight | 30386.75 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP06699
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.38| 10| 88| 57| 72| 1
---------------------------------------------------------------------------
57- 72 (17.83/17.29) PDWQltqlekPRVDWI
147- 156 (24.55/11.00) PEWH......RHVDWI
---------------------------------------------------------------------------
|