<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06695
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MDLTDLHPPDDYTHRFFIWHEWIQANGPLTPENVFDYFATSMFYDKQSNNQVLRMQTMHTGIPIANEAEELRRFTGIEFALVHAQPPSFFIIHKRERLSPDEGIPLAAYFVVHNRIYQSPDVYSVLSNRLLTAVHSLQASLDVLRKHRPDYTPRTGFVWPIADPTISDDASKTRKHDPDNTTVPEQPDALTDTDKRLRNPAKREQNNILLLNAMRTTAAHSRLSYTPISAEAADTGTAAADTPAPSIAQVRSSTTPAPGPQEQAVKGSPSTAATTQEAAAKVPTGGGKKKKKRMCLICSPKVCSKLWETLSGTSLAAPSAPT |
| Length | 322 |
| Position | Head |
| Organism | Leucoagaricus sp. SymC.cos |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Agaricales> Agaricaceae> Leucoagaricus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.501 |
| Instability index | 46.56 |
| Isoelectric point | 7.79 |
| Molecular weight | 35567.70 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06695
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.93| 18| 71| 16| 38| 1
---------------------------------------------------------------------------
16- 38 (34.96/28.89) FFIWH..EWIQAN.G.PLTPenvfdYF
89- 110 (22.97/ 9.95) FFIIHkrERLSPDeGiPLAA.....YF
---------------------------------------------------------------------------
|