<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06693
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MATPKIENNNNQLEQSGESENHPDIEQRFQVELEFVQCLANPWYLNFLAQQSYFEQKEFVNYLKYLKYWKRPEYAKFIIYPHCLYFLDLLQHEEFRQSIKSIDAATFIHSRQYYHWLYSNRPKVDEAKNNEQENNDQSQADNENMAVKSEANTATLS |
Length | 157 |
Position | Middle |
Organism | Conidiobolus coronatus (strain ATCC 28846 / CBS 209.66 / NRRL 28638) (Delacroixia coronata) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Zoopagomycota>
Entomophthoromycotina> Entomophthoromycetes> Entomophthorales>
Ancylistaceae> Conidiobolus.
|
Aromaticity | 0.15 |
Grand average of hydropathy | -0.924 |
Instability index | 52.56 |
Isoelectric point | 5.10 |
Molecular weight | 18873.65 |
Publications | PubMed=25977457
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP06693
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.07| 20| 28| 33| 59| 1
---------------------------------------------------------------------------
26- 48 (32.44/22.56) EQRFqveLEFVQCLANPWYLNFL
56- 78 (31.62/ 9.90) QKEFvnyLKYLKYWKRPEYAKFI
---------------------------------------------------------------------------
|