<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06688
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MNPKVPFPKPPYLYKNYKDNLMEKINPMLSSKQLPEDKTLEKFLPPKIPNTDNYCVFGEHLSVKEIEFDNSITNKQAIDTIKNLKSLNHSLIFYFLDLINELGKEGGGQTNQIIQKIEQTFLNLHNLINYYRPIQARKNLFSILNYQLNQILTGRRSFNECISNIKTTIIQLKTIIEDIELNNNVNIQLNPIEVQNTLNLIKSKTKTKRDITPSKKIQCTHLDEVYDPNLLQLIDNII |
Length | 238 |
Position | Middle |
Organism | Conidiobolus coronatus (strain ATCC 28846 / CBS 209.66 / NRRL 28638) (Delacroixia coronata) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Zoopagomycota>
Entomophthoromycotina> Entomophthoromycetes> Entomophthorales>
Ancylistaceae> Conidiobolus.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.463 |
Instability index | 46.14 |
Isoelectric point | 8.78 |
Molecular weight | 27685.69 |
Publications | PubMed=25977457
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP06688
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 100.15| 33| 40| 111| 149| 1
---------------------------------------------------------------------------
76- 109 (51.91/22.74) QAIDTIKNlKSLN.HSLIFYF..LDLINELGKEGGGQ
112- 147 (48.24/30.15) QIIQKIEQ.TFLNlHNLINYYrpIQARKNLFSILNYQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.30| 24| 30| 178| 201| 2
---------------------------------------------------------------------------
178- 201 (40.05/19.56) DIELNNNVN.IQLNPIEVQNTLNLI
210- 234 (35.26/16.53) DITPSKKIQcTHLDEVYDPNLLQLI
---------------------------------------------------------------------------
|