<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06686
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MSTNLPPVQAQNPNSTIPPINLERIEDPKNPFFKTSLKAYMNDLLKQYLQSIQKLFKLINGTIEGKTNSLPNIPEALNDLLEVNEKLNSALPYLINHRRIQAHLDAIDHELVKEERAVFKMIEQLQVAKANLYQLISKAEGKQSEIEKDRVVDIPTVLSYAQRISATTSAPPNFDNQSRNIPAEPPYPGEVVMRSGLLAHPDLIQPLRSKLDRDGEAVDMLNLDQSEVKVDDDEQFIHKDDADRVYSHFGTDHSAPRDSEKVKALFDEFDFSGSDE |
| Length | 276 |
| Position | Middle |
| Organism | Conidiobolus coronatus (strain ATCC 28846 / CBS 209.66 / NRRL 28638) (Delacroixia coronata) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Zoopagomycota>
Entomophthoromycotina> Entomophthoromycetes> Entomophthorales>
Ancylistaceae> Conidiobolus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.595 |
| Instability index | 47.24 |
| Isoelectric point | 4.98 |
| Molecular weight | 31212.75 |
| Publications | PubMed=25977457
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06686
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 106.09| 33| 35| 26| 60| 2
---------------------------------------------------------------------------
26- 60 (51.57/36.40) EDPKNPFfkTSLKAYMNDLLKQYLQSIQKLFKLIN
64- 96 (54.52/32.32) EGKTNSL..PNIPEALNDLLEVNEKLNSALPYLIN
---------------------------------------------------------------------------
|