<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06684
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MSETELLNIEWRLPEWIMHNGGVLTFENVMDYFSLSPFWDPNSNNAVIKMQTTNNSIDQANMDLTKMTGIEFVILKHDILELEGSSLFVIQKQRRSSPDDVVPIALYYVLNGNIYQCPDLYSVLANRTMTSLYHLMSAFKESSQAVNFLPFRGYRWNNDPQFSGENKNTKLNNQQIQNYRNCAGKAFFKAMSLPTEPTPKPKPKQVSQTEAGKEGNENDQTEQKSGATAAVKKELNDEEKPSPKPKRKKTGDGTRAKRKKSQADQTQQP |
| Length | 269 |
| Position | Head |
| Organism | Conidiobolus coronatus (strain ATCC 28846 / CBS 209.66 / NRRL 28638) (Delacroixia coronata) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Zoopagomycota>
Entomophthoromycotina> Entomophthoromycetes> Entomophthorales>
Ancylistaceae> Conidiobolus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.826 |
| Instability index | 52.49 |
| Isoelectric point | 8.66 |
| Molecular weight | 30605.15 |
| Publications | PubMed=25977457
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP06684
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 168.29| 41| 41| 183| 223| 1
---------------------------------------------------------------------------
149- 180 (38.31/20.08) ..........LPFRGYRWNNDPQFSgE.NKNTKLNNQQIQNYR
183- 223 (70.45/42.79) AGKAFFKAMSLPTEPTPKPKPKQVS.Q.TEAGKEGNENDQTEQ
227- 268 (59.54/35.08) ATAAVKKELNDEEKPSPKPKRKKTG.DgTRAKRKKSQADQTQQ
---------------------------------------------------------------------------
|