<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06676

Description Uncharacterized protein (Fragment)
SequenceMKIDLTNSPSNLIKLKNIQSIQYLEFSTKDPNSSHQSAYLTPSQMNIQLIELKKRLNKLNSIIYDYDLMTYNLDQKLMGELKFYFFIINGSENVDKFRNLIKFKDFKLFELKHVTLTKKNLKNQNFCEFNKNNFEGLEGLLSFPNNFNQQIKDLIPILQAFLKAFRKTLNRSLCEAGGVLFGDEIVQICWNPAYNPNSTWYFKGLPHNPDWPTLEETSLQYHLWFNHGTLYCSVNAKKHNTRLIEWDDVKKIASESPALQSDPLNPVINLEFPVQALSSPHLAPIEILGFPFGLTEEVETLILKRWCTVLNLPTFKGPNNCQQPFKKSSPRIPNLTYVRFTKADNQSIILFPTFAIFIPLPEEYFDSIQFTSKTTWNLAWDYTEIYFNMMEYILLNTNLTPQQHQQQNNNNNNNNNLRPLPRETSQSSINSPQALIPHPPTPSAIDYGRLGRELDTWDYLSTQFATSDSTQTQNQPLHFTPTHIQSLPAPSQSTQNPTDDFSTNFFDDLDLNNFNLNNMDPLHQNLNLGGFDSLDVTDEDFSFFDEKKDNNNQQGQQMSMITGGQVQQSPKLIGLFDEPSSINNGNESKDGGLAGNNGGSGSNAAGLVAKSATNSTSKLGEPIKEEQVKATTKASTQTSNVKEIKLTSTQTSSLAGNKRYPTYLASDYAPIKQFATYKPTLKLEKFERLKPKN
Length693
PositionKinase
OrganismConidiobolus coronatus (strain ATCC 28846 / CBS 209.66 / NRRL 28638) (Delacroixia coronata)
KingdomFungi
LineageEukaryota> Fungi> Fungi incertae sedis> Zoopagomycota> Entomophthoromycotina> Entomophthoromycetes> Entomophthorales> Ancylistaceae> Conidiobolus.
Aromaticity0.11
Grand average of hydropathy-0.585
Instability index42.66
Isoelectric point6.11
Molecular weight78829.75
Publications
PubMed=25977457

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP06676
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      78.86|      19|      19|     255|     273|       1
---------------------------------------------------------------------------
  255-  273 (34.40/18.36)	ESPALQSDPLNPVINLEFP
  275-  291 (24.60/11.32)	..QALSSPHLAPIEILGFP
  297-  312 (19.86/ 7.92)	EVETLILKRWCTVLNL...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.80|      18|      19|     349|     366|       2
---------------------------------------------------------------------------
  349-  366 (33.95/21.61)	ILF...PTFAIFIPLPEEYFD
  368-  388 (30.85/18.93)	IQFtskTTWNLAWDYTEIYFN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.84|      12|      19|     396|     412|       3
---------------------------------------------------------------------------
  396-  408 (19.66/ 9.75)	N.TNLTPQqHQQQN
  515-  527 (20.18/ 9.45)	NlNNMDPL.HQNLN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.98|      19|      19|     469|     487|       4
---------------------------------------------------------------------------
  469-  487 (34.78/20.53)	STQTQNQPLHFTPTHIQSL
  491-  509 (34.20/20.06)	SQSTQNPTDDFSTNFFDDL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.23|      10|     111|     202|     212|       5
---------------------------------------------------------------------------
  202-  212 (20.25/13.85)	FKGlPHNPDWP
  315-  324 (22.98/11.31)	FKG.PNNCQQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.25|      14|      19|     412|     425|       6
---------------------------------------------------------------------------
  412-  425 (25.64/12.02)	NNNNNLRPLPRETS
  430-  443 (27.61/13.47)	NSPQALIPHPPTPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.98|      19|      19|     125|     143|       7
---------------------------------------------------------------------------
  125-  143 (34.63/18.69)	NFCEFNKNNFEGLEGLL.SF
  146-  165 (28.35/14.08)	NFNQQIKDLIPILQAFLkAF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     106.97|      31|      34|     543|     575|       8
---------------------------------------------------------------------------
  544-  574 (54.11/27.73)	FDEKKDNNNQQGQQMSMITGGQVQQSPKLIG
  576-  606 (52.86/26.35)	FDEPSSINNGNESKDGGLAGNNGGSGSNAAG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP06676 with Med13 domain of Kingdom Fungi
Unable to open file!