<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP06675

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMTNQVSASYPSNSNNVNNNTDYSNLRDKSMNGTNPQFPFETIAPTPDAIPDNSNSEGGEPSSPTFLTLPTDNFNTVPLRQLVQNFIYQANNDLNMAVDTLDSAKGDDKKRQLLNYVQTQRDRIAKVLVLVKWAAKASSIQKCQNIIGFLNTQNQLFNSSVNDLFQFYQNLPSLRVRNYDVKNSIDVLTTGSFTGLPKIIKDTFVNPDPLSEDEIRNTLGMVNDFVLLKLISIEDIPSWLKHAKSVENAKLTLTVKDEYEIVLTLKGLDTSLPWHLITVKILIDHNNLKEDSRTILTPIQQSQLEYQAQQQLLPPHLKQYPPGVSAPEPPVNPNKKAKKSDIVALHKFLHNFCGSLILESLILQAQPLSEVNWKGQLYLSQTPTSLTIHYWTSKGSPNFKDNYSSLGNSDQHTFTITLRSKVDPPLTEWKHAKMLETNPFFSKPVEDMFKVDPACLNFENILLEVVRAHSVLILYTYRDIILKANRGQANFSPDQVKLFNEEGQVPYLTVDYGYKRSAKLTVDPRIGKINLTLVYDPERESIMAEVGRKLNENPENASNIMMELRFLMILDDIKSISTFCNLLPVNPVTFKPGENNIFGNQVKRTLFLQFSSHSQYHLVFTATDHSIHCWIVIIELSPTTQKKSISCYKEIAINNLEEDNPNAEDIKPNFYQVPVPNISDLWDIQRLKSISQLGLDLAAYLKIGPLLTQGLSVLFDGADTNLKSFLPTLNNPANEAMFEFTPVHSSSLPSPVSGWDGPITVIQDSINRKSVSFKIKLNYTKFPLAANPTNSTLMSLPNHWSIDVSGSYLTFTYFDLNDCWNSFISDWSIFTHVASLTHQIYYLKWYSSFNIDINLYSCNSLVLLFENKIHIGITWKPDSKIKTSGEYHLEFPTSSTHPRNPFTLTQPFLHAYLNRTKSLRGLIHIVKDTYQFVNGIDTHILEGKRKYSIIPRSENEIRFIYSNMFGFDLTLLKDNQIAFTYIHKIIDGDASAPKITTPAPWKPESIAPEARGTWVVSQQFKPETNKTYLDVVQCLPQLILQTIPPPNNGPSAVTTRQSGMITTSPENTFYLLLAMDWSFCNINILRFIGSWDNRETPKIEVKLDWANNSVSFKAADFKVELRLLNMCNWKATLERLPTSSAESFTNEEINSLCNQVQKQLNENKYDVIIAKGIVQLFLLPAVLIKMLIGSFELQNPQTGVSMSLKLTPLSTNFPAKVIEYVQDIGNFSLLFNLRCNDQKYVLPLTYNFFSQEISFQNNDNNNYPSIPAYITQPFEALRGNNGLSDPNLATKLQLFIQNFNPQTSETMVDADF
Length1311
PositionTail
OrganismConidiobolus coronatus (strain ATCC 28846 / CBS 209.66 / NRRL 28638) (Delacroixia coronata)
KingdomFungi
LineageEukaryota> Fungi> Fungi incertae sedis> Zoopagomycota> Entomophthoromycotina> Entomophthoromycetes> Entomophthorales> Ancylistaceae> Conidiobolus.
Aromaticity0.10
Grand average of hydropathy-0.278
Instability index37.20
Isoelectric point6.13
Molecular weight148708.58
Publications
PubMed=25977457

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU365082
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP06675
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.80|      16|      34|     764|     783|       1
---------------------------------------------------------------------------
  764-  783 (19.97/26.04)	SINrKSVSFkikLNYTKFPL
  800-  815 (29.83/19.97)	SID.VSGSY...LTFTYFDL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      94.80|      25|     365|     883|     907|       2
---------------------------------------------------------------------------
  883-  907 (47.93/29.11)	SGEYHLEFPTSSTHPRNPFTLTQPF
 1249- 1273 (46.87/28.27)	SQEISFQNNDNNNYPSIPAYITQPF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.66|      18|      28|      32|      50|       3
---------------------------------------------------------------------------
   32-   50 (32.53/22.45)	GTNPQFP.FETIaPTP..DAIP
   57-   77 (26.13/12.67)	GGEPSSPtFLTL.PTDnfNTVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.53|      15|      28|     420|     435|       4
---------------------------------------------------------------------------
  420-  435 (24.64/21.35)	KVDPPLTEWKHAkMLE
  449-  463 (26.89/17.70)	KVDPACLNFENI.LLE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.37|      20|     104|    1179|    1201|       6
---------------------------------------------------------------------------
 1179- 1201 (31.71/22.35)	P..AVLIKMLIGSFelqNPQTGVSM
 1285- 1306 (32.66/15.95)	PnlATKLQLFIQNF...NPQTSETM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     239.71|      80|     341|     675|     760|       7
---------------------------------------------------------------------------
  675-  760 (125.88/86.20)	PNISDLWDI.QRLK.SISQLGLDLAAYLKigPLLTQGLSVLFDG..ADTNLKSFLPTlNNPANE.....AM.FEFTPVHSSSLpspVSGWDG...P.ITV
 1007- 1100 (113.83/62.47)	PEARGTWVVsQQFKpETNKTYLDVVQCLP..QLILQTIPPPNNGpsAVTTRQSGMIT.TSPENTfylllAMdWSFCNINILRF...IGSWDNretPkIEV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.24|      12|      29|      79|      92|       8
---------------------------------------------------------------------------
   79-   92 (13.12/15.49)	RQLVqNFIyQANND
  110-  121 (22.12/11.89)	RQLL.NYV.QTQRD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.59|      11|      23|     819|     829|       9
---------------------------------------------------------------------------
  819-  829 (23.29/16.63)	W.NSFISDWSIF
  844-  855 (17.30/ 9.90)	WySSFNIDINLY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.38|      19|     341|     205|     231|      11
---------------------------------------------------------------------------
  208-  228 (31.03/32.16)	PLSEDEIR....NTLGMvnDFVLLK
  950-  972 (31.35/ 8.90)	PRSENEIRfiysNMFGF..DLTLLK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP06675 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MTNQVSASYPSNSNNVNNNTDYSNLRDKSMNGTNPQFPFETIAPTPDAIPDNSNSEGGEPSSPTFLTLP
1
69










Molecular Recognition Features






MoRF SequenceStartStop




NANANA